KEGG   Aliivibrio salmonicida: VSAL_I1289Help
Entry
VSAL_I1289        CDS       T00782                                 

Definition
(GenBank) alkaline-resistant alpha-amylase precursor
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VSAL_I1289
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VSAL_I1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1398517..1399893
Genome map
AA seq 458 aa AA seqDB search
MSQGMAGQLHNIPAVSNVILHAFDWTYQSIAEQAEQIAALGYRSVLVSPAMKSLQLPSGT
QWWQRYQPQDYRLIDNPLGNTSDFKHMIERLAEFNLWVYVDVVFNHMANESDIRADLQYP
NRWDREDYEKDPIKYHALTLFGDLSEPLFTEPDFVDAFGIENWNDKWEVQNGRISGGPHD
PGLPTLIDNEHVVEQQRAYLLALKSMGVKGFRIDAAKHMSLEHLNKVWTDDITNDVHIFG
EIITDGGATKEEYETFLSPYLMGTTLGAYDFPLFNILYQAFEKKGSLTSLIDPYCYGLAL
SPLRAITFAITHDIPNNQVFKSLVMSEHNEWLAYAYLFGREGGIPLVYSDLDTSGITNSF
GSPRWKNAWKEEKMSGLIHFHHRMYGEGQTLIEASDDHLVFARGDQGIVALNKSNKNIEV
SMSSDSEWREFSSNQLCQKKEGVLVFSIPKYSYLLLCH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagggaatggcgggacaattacataatatacccgcagtaagtaatgtcattctt
catgcgttcgactggacctatcaaagcattgctgaacaagcagagcagattgccgcatta
gggtatcgttctgtgttggtttcccctgcaatgaaatcacttcaattaccctcgggtact
cagtggtggcagcgctatcaacctcaagactatcgtttgattgataatccattaggcaat
acctctgattttaaacatatgatagagcgtcttgctgaatttaatttatgggtttatgtc
gatgttgtgtttaatcacatggcaaacgaatcagacattcgagcggatcttcaataccca
aatcgatgggatagagaggattacgaaaaagacccgataaaatatcacgcgttaacgctg
tttggtgatctctctgaacctctttttactgaacctgattttgttgatgcttttggtatt
gagaattggaatgataaatgggaagttcaaaatggccgcatatctgggggacctcatgat
ccaggtttacctaccttaattgataatgaacatgttgttgagcaacagcgtgcttattta
ttggcattgaagtcgatgggagtaaaaggttttcgtattgatgcagcaaagcacatgagc
cttgaacacctaaataaagtatggactgacgatataaccaatgatgtacatatctttggt
gagataattactgacggtggagcaacaaaagaagagtatgagacgtttttaagtccctat
ttaatgggaaccacgttaggtgcttacgactttcctttatttaatattctttatcaagcg
tttgagaaaaaagggtcgttaacgtcattaatcgatccttattgctatggcttggctttg
tctcctttacgtgcgattacttttgccattactcatgatattccgaataaccaagtattt
aaaagtttggtgatgagtgagcataacgagtggttagcttatgcgtatttatttggtaga
gaaggggggatcccgttggtttattcggatttagataccagtggtatcactaattcattt
ggttccccacgctggaaaaacgcatggaaagaagaaaaaatgtcaggattgattcatttt
catcatcgtatgtatggagaagggcaaactttgattgaagcgagtgacgatcatcttgtt
tttgcacgaggagatcaaggtattgtggcgttaaataaatcgaacaagaatattgaagtg
agtatgtcatcggacagtgagtggagagagttttcatccaatcaattgtgtcagaaaaaa
gaaggcgtacttgtgtttagtattcctaaatattcttatcttttattgtgtcattaa

DBGET integrated database retrieval system