KEGG   Vibrio tasmaniensis: VS_2972Help
Entry
VS_2972           CDS       T00812                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
vsp  Vibrio tasmaniensis
Brite
Translation factors [BR:vsp03012]
 Eukaryotic Type
  Elongation factors
   VS_2972
 Prokaryotic Type
   VS_2972
Mitochondrial biogenesis [BR:vsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VS_2972
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VS_2972
  Exosomal proteins of breast cancer cells
   VS_2972
  Exosomal proteins of colorectal cancer cells
   VS_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3132912..3134150)
Genome map
AA seq 412 aa AA seqDB search
MVAWSYFKPPNPYLEGHPMSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGG
VAKDFASIDNAPEERERGITIATSHVEYDTPERHYAHVDCPGHADYVKNMITGAAQMDGG
ILVVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYE
YPGDDLPVIQGSALGALNGEKQWEDKIVELAEALDSYIPLPERAVDLPFLLPIEDVFSIQ
GRGTVVTGRIERGILRVGDEVEIVGIKETTLTTCTGVEMFRKLLDEGRAGENVGALLRGT
KRDDVERGQVLSAKGSINPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDI
TLPEGVEMVMPGDNVQMTVELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcgtggtcttattttaagccacctaatccgtacctagagggacaccccatgtct
aaagaaaaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccacgttgac
cacggtaaaacaactctaactgctgctatctgtactacacttgcaaaagtgtacggcggt
gttgctaaagatttcgcatctatcgataacgctccagaagagcgcgagcgcggtatcaca
atcgcaacttctcacgttgagtacgatactcctgaacgtcactacgcacacgtagactgt
cctggacacgccgattatgttaaaaacatgatcactggtgctgctcaaatggacggcggt
atcctagttgttgctgctacagatggccctatgccacaaactcgtgagcacatcctactt
ggtcgtcaagttggtatcccttacatcatcgtattcatgaacaaatgtgacatggttgat
gacgaagagctacttgagctagtagaaatggaagttcgtgaacttctttctgagtacgag
tacccaggagacgacctaccagtaattcaaggttctgcacttggcgctctaaacggcgaa
aagcagtgggaagacaagatcgttgagcttgcagaagcactagattcttacattccactt
ccagagcgtgcagttgatctaccgttcctacttcctattgaagatgtattctcaatccaa
ggtcgtggtactgtagttactggtcgtatcgagcgcggtatcctacgtgtaggtgacgaa
gtagaaatcgttggtatcaaagagactactcttactacttgtactggtgttgaaatgttc
cgtaaactgcttgacgaaggtcgtgcaggtgagaacgttggtgcacttctacgtggtact
aagcgtgatgacgttgaacgtggccaagtactttctgctaaaggttcaatcaacccacac
actaagtttgagtctgaagtatacgtactttctaaagacgaaggcggccgtcacactcct
ttcttcaagggttaccgtccacagttctacttccgtacaactgacgtaacaggcgatatc
actctacctgaaggcgtagaaatggtaatgccaggtgacaacgttcaaatgactgttgag
ctaatcgctccaatcgcaatggacgaaggtctacgtttcgcaatccgcgaaggtggccgt
acagttggtgctggtgttgtagctaaaatctttgcataa

DBGET integrated database retrieval system