KEGG   Vitis vinifera (wine grape): 100256481Help
Entry
100256481         CDS       T01084                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00250  Alanine, aspartate and glutamate metabolism
vvi00410  beta-Alanine metabolism
vvi00430  Taurine and hypotaurine metabolism
vvi00650  Butanoate metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100256481
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100256481
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100256481
   00430 Taurine and hypotaurine metabolism
    100256481
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100256481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 100256481
NCBI-ProteinID: XP_002270937
UniProt: D7TA34
LinkDB All DBs
Position
4
AA seq 488 aa AA seqDB search
MALSETASESNASIHSTFASRYVRVSLPRFKIPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPHDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTDGYYVMDPVKAVEMVDENTICVAAILGSTLNGEFEDVKHLNDLLTKKNKETGWDTP
IHVDAASGGFIAPFLHPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNIMENCQENARVLKEGLEK
TGHFNIVSKENGVPLVAFSLKDNSCHNEFEVSDMLRRYGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVTDIQKVLYELDTLPAKITAKVQQSNKKSEIETQREITEAWKKFVRE
KKKTNGVC
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtcggagacggcatcagagtccaatgcctccatccactccaccttcgcttct
cgatatgttagagtttcgctcccaaggttcaagattccggagaattcgataccgaaggag
gcagcgtaccagataataaacgacgagctgatgctggatgggaacccgaggctgaacctg
gcttcatttgtgacaacatggatggaaccagagtgcgataagctaatcatggcctccatt
aacaagaactacgttgatatggacgagtaccctgtcaccactgagctacagaatcgctgc
gtaaacatgatagcacatctatttaatgcaccacttggagagtcggaggcagcagttggt
gtgggaacagtgggatcttcagaggcaataatgcttgctggtttggcattcaagaggaag
tggcaaaacaagaggaaagctgagggcaaaccccatgacaagcctaacattgttactgga
gctaatgttcaggtgtgctgggagaaatttgcaaggtactttgaggtggaattgaaggaa
gtgaagctgacggatggctactatgtgatggaccctgtcaaagcagtggagatggtggac
gagaacaccatctgtgttgctgctatccttggttctaccctcaatggagaattcgaagat
gttaaacacttgaatgatcttttgacaaagaaaaacaaagaaacaggatgggatactcca
atccatgtagatgcagcaagtggtggctttattgcaccctttcttcacccagagctggag
tgggacttccgcttgccacttgtgaaaagcattaatgttagcggccacaagtacgggctt
gtgtatgctggcataggttgggtgatttggaggagtaaagaggacttgcccgatgagctc
atctttcatatcaactatcttggagccgaccaacctaccttcaccctcaacttctccaaa
ggttctagtcaagttattgctcagtattatcaactcattcgcttgggccatgagggatat
aggaacattatggaaaactgtcaagaaaatgcaagggtgctcaaagaaggattggagaag
acagggcacttcaacattgtgtctaaagagaatggagtgccattagtagccttctctttg
aaagacaacagctgtcacaatgagttcgaggtgtcagacatgctgcgacgctatggatgg
atcgtgccagcttataccatgccgccggatgcacaacatgtgactgttcttcgtgtcgtc
ataagagaagatttctcgcgcacacttgctgagcgtctggtcacagatatccaaaaagtc
ctatatgagctcgatactctccccgctaagattacagccaaggtccaacagagcaacaag
aagagtgaaattgagacacagagggagatcaccgaagcttggaagaagttcgtcagggag
aagaagaagactaatggcgtttgttag

DBGET integrated database retrieval system