KEGG   Vitis vinifera (wine grape): 100256907Help
Entry
100256907         CDS       T01084                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03030  DNA replication
vvi03410  Base excision repair
vvi03420  Nucleotide excision repair
vvi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100256907
   03410 Base excision repair
    100256907
   03420 Nucleotide excision repair
    100256907
   03430 Mismatch repair
    100256907
Enzymes [BR:vvi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100256907
    6.5.1.6  DNA ligase (ATP or NAD+)
     100256907
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100256907
DNA replication proteins [BR:vvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100256907
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100256907
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100256907
   NER (nucleotide excision repair)
    Other NER factors
     100256907
   MMR (mismatch exicision repair)
    Other MMR factors
     100256907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 100256907
NCBI-ProteinID: XP_002272683
LinkDB All DBs
Position
6
AA seq 782 aa AA seqDB search
MLGLRSCHCLGHNPLSRSLNLRFSPPLSASFKSFSLNSFFSSSPNPKTKPKPQSKRKPTM
SSLPSAFDALMSKARAAAKKKPQSQSESQSQSSSPKKRKTQTQTPDLAPPKKSTNSQTPD
SKIEPLDALPAKKPKKVDVEECIGQLRKKAADFNPKTAAYWEDKPVPFLFLVRAFDMISK
ETGRIVITDIVCNMLRTVMHATPDDLVAVVYLSANRIAPAHEGLELGIGDASIIKALAEA
CGRKEEQIKSQYKALGDLGLVAKACRSSQSLMRKPDPLTVAKVFNTFGLIAKESGKDSQE
KKKNHIKTLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLTALGQAAVYNDKELTQPPPHI
QSPLEEAANIVKQSYSVLPVYDKIVPALLSGGVWNLPKTCSFMPGVPVGPMLAKPTKGVS
EIIDKFQDMEFTCEYKYDGERAQIHYKEDGSVEIYSRNAERNTGKYPDVVVAVSRLKKSS
VSSFVLDCELVAYDRQKGKILPFQVLSTRARKNVVMSEIKVDVCIFAFDILYRNGQPLLQ
EQLKIRREHLYESFEEEPGFFQFATAITSNDLEEIQKFLEAAVDTSCEGLIIKTLNGDAT
YEPSKRSHNWLKLKKDYMENIGDSLDLVPIAAFHGRGKRAGVYGAFLLACYDSNKEEYQS
ICKIGTGFSEAVLEERSASLRSKVISRPKPYYRYADSIDPDVWFEPTEVWEVKAADLTIS
PVHRAAVGIVDPNKGISLRFPRLVRIRDDKNPEQASSSDLVAEMYNGQKLNHQSNQDENE
ED
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtctgcgttcatgccactgtcttggccacaaccctctctctcgcagtctcaac
ctccgcttctctcctcctctttcggcctcattcaaatccttctctcttaattctttcttc
tcgtcaagccctaaccctaagactaaacctaaaccccaatctaaacgtaaacccaccatg
tcctctctcccctccgccttcgatgctctcatgtccaaagcccgagccgcggccaagaag
aagccccaatcccagtccgaatcccaatcccaatcctcgtctccgaagaagcgcaaaacc
caaactcaaaccccagaccttgccccacctaaaaaatctaccaattcccaaacccccgat
tccaagatcgaaccattggatgcgttgccggcgaagaaaccgaagaaggttgacgtcgaa
gagtgtattgggcaattgaggaaaaaggcggcggatttcaatcccaaaacggcggcgtat
tgggaggacaagccagttccatttctttttcttgtcagggcttttgatatgatttccaag
gagacgggtcggattgtgattacggatattgtgtgcaatatgttgaggacggtgatgcac
gccaccccggacgatttagtagcggttgtctatctttcagccaacaggattgcgccggcg
catgagggcttggagcttgggattggggatgcgtcaattattaaggcacttgcggaagcc
tgtggaagaaaagaagagcagattaagagccagtacaaggcattgggagatttggggctt
gttgcaaaagcatgccgatcatcccagtctctgatgcgcaagcctgatccattaaccgtt
gccaaggtttttaatacatttggacttattgccaaggaatctggaaaggatagtcaagag
aagaaaaagaaccatatcaagacacttcttgttgcagccaccgactgcgagccacagtat
ttaattcgtctacttcagacgaagttgcgaattggtttggcagagcaaactctgttaact
gcattgggacaagctgctgtatataatgacaaagagttgacacaaccacctccacatatc
cagtcgcctctagaggaggctgcaaatattgttaagcaatcgtactctgtacttcctgtt
tatgataaaatagtccctgctcttcttagcggtggtgtatggaatcttccaaagacatgt
agctttatgccaggtgtccctgttggacctatgctagcaaaaccaaccaagggggtatct
gaaatcattgataaattccaggatatggaattcacctgtgaatacaaatatgatggagaa
cgtgctcagatacactacaaggaggatgggtcagttgagatatatagtcgcaatgccgaa
cgaaatactggaaagtatcctgatgttgttgttgcagtttcaagattaaagaagtcatct
gtgagttcatttgttttggattgcgaactagttgcctatgaccgtcaaaaggggaaaatt
ttgccattccaggtcctcagcacccgtgctcgtaaaaatgtggttatgagtgaaatcaag
gttgatgtttgcatatttgcttttgacattttgtatcgtaatggccaaccacttcttcaa
gagcagctcaaaattcgtcgtgagcatctttatgagtcatttgaggaagaacctggattt
ttccagtttgcaacagcaataacatcaaatgatcttgaggaaatacaaaaattccttgaa
gctgctgttgataccagttgtgaaggcttgatcattaaaacattgaatggagatgctaca
tatgagccttcaaagcggtcacataactggctaaaattgaagaaagattacatggagaat
attggtgactcgcttgatctagtacctatagctgctttccacggtcgcgggaaacgtgca
ggtgtctatggtgccttcctccttgcttgttatgacagcaataaagaagaatatcaaagc
atttgtaaaataggcactggattttctgaggcagtgcttgaagaacgctcagccagtctt
cgttctaaagtgatttccagaccaaagccttactatcggtatgctgattcaattgatcca
gatgtatggtttgaacccactgaggtttgggaggtgaaagctgcagacttgaccattagc
cctgttcatcgtgctgcagttggaatagtggatcctaacaagggtatttctcttcggttt
ccacgtctggttcgcattcgagatgataagaatccagagcaagcgtcgtcatctgacttg
gttgctgagatgtataatggccaaaagctcaatcaccagtccaatcaagatgaaaatgaa
gaagactga

DBGET integrated database retrieval system