KEGG   Vibrio vulnificus 93U204: VV93_v1c32800Help
Entry
VV93_v1c32800     CDS       T03294                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vvl  Vibrio vulnificus 93U204
Brite
Enzymes [BR:vvl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VV93_v1c32800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(326606..327118)
Genome map
AA seq 170 aa AA seqDB search
MNKHTLLAAILLYSTSSFAQSLSVDMKDLSSNQTLGTVTISSSDYGTVFTPDLKGLPSGL
HGFHLHANGSCESSNKDGKVVLGGAAGGHYDPQNSGKHGYPWTEDNHLGDLPALFVDASG
NASQPVLAPRVALKDVQGRALMIHAGADNHSDHPMPLGGGGARIVCGVIK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacacaccttacttgctgccattttgctttattcgacctcttcatttgcgcag
agtttgagcgttgacatgaaggacctatccagcaatcaaacactcggcaccgtgaccatc
agttcaagtgactacggaacggtgtttactcctgatcttaaggggctacctagtggcctg
cacggttttcatctccacgccaatggaagctgtgagagcagcaacaaagacggcaaagtg
gtattaggaggggcggctggtggacactatgatccgcaaaatagtggcaaacacggctat
ccatggacagaagacaatcaccttggcgatctaccagcactgtttgttgatgcatcaggt
aacgcgtcacagccagtgcttgcccctcgtgttgcgttaaaagatgtccaaggccgcgct
ctgatgatccatgctggggctgacaatcactctgatcacccaatgcctctgggcggcggc
ggtgccagaattgtgtgtggtgtgatcaaataa

DBGET integrated database retrieval system