KEGG   Wallemia ichthyophaga: J056_001033Help
Entry
J056_001033       CDS       T03457                                 

Definition
(RefSeq) Glucokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00010  Glycolysis / Gluconeogenesis
wic00051  Fructose and mannose metabolism
wic00052  Galactose metabolism
wic00500  Starch and sucrose metabolism
wic00520  Amino sugar and nucleotide sugar metabolism
wic01100  Metabolic pathways
wic01110  Biosynthesis of secondary metabolites
wic01130  Biosynthesis of antibiotics
wic01200  Carbon metabolism
Module
wic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
wic_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:wic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J056_001033
   00051 Fructose and mannose metabolism
    J056_001033
   00052 Galactose metabolism
    J056_001033
   00500 Starch and sucrose metabolism
    J056_001033
   00520 Amino sugar and nucleotide sugar metabolism
    J056_001033
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    J056_001033
Enzymes [BR:wic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     J056_001033
Membrane trafficking [BR:wic04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    J056_001033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 20373985
NCBI-ProteinID: XP_009268936
UniProt: R9AD97
LinkDB All DBs
Position
Unknown
AA seq 454 aa AA seqDB search
MNFSEKLIVDDNALFKIKNEIQAEFSHGLNYHGTDVSMIPTFVYGLPDGTECGTYLSLDL
GGTNMRVCEVNLSGDRNFSISQEKYKITEDLKTGEFTELFSYMAKSIGHFISTKSQSKQG
QRIPLGFTFSFPVDQSAINSGKLIGFTKGFNAKNAVGKDVVETLQDCLNKQNIPVDVVAL
VNDTVGTLLAHSYQSGGAKIGAIFGTGTNGAYLEDLTEIKKLDDEAKNPKAGSKMVVNTE
WGNVDNARSVLPITEWDDIVDSASINPRRQSFEKLISGMYLGEILRRLLVDLHAKQEFLS
NTSTLPEAFNTQYGLDTALMSDSLRDSDGETTHTKQVLGALGVSAENVRELDAQLFRDAS
QLIGLRAARFSACALAAVIESEASENAAGDINIGLDGSVIEFFPRFEQSIRDALNVILGN
QAEKRIKIGLAKDGSGVGAALCALQAIKQGVAKK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaacttctctgaaaaattaatcgtcgacgacaacgccctgtttaaaatcaaaaatgaa
attcaagctgagttctctcacggccttaattaccacggcacagacgtatcgatgatcccc
acgttcgtctatggcttgccggatggaactgaatgcggcacctatttaagcctggacctg
ggcggcacaaatatgcgtgtctgtgaagttaatctttctggtgacaggaacttctccatt
tctcaggagaagtataaaatcactgaggatctcaagacaggcgagttcactgagttattc
tcgtacatggccaaatctattggtcactttatatccacaaagtctcaatccaagcaaggt
cagagaatcccactcggtttcaccttctccttccccgtcgatcagtctgctatcaactca
ggcaaattgatcggcttcaccaagggcttcaatgccaagaatgccgttgggaaggatgtc
gttgagacgctacaggattgtctcaataagcaaaacattcctgtcgatgtcgttgcgttg
gtcaatgatactgtcggcactttgctcgctcactcgtatcaatctggcggtgcgaagatc
ggtgctatctttggcactggcactaacggtgcgtacttggaagatcttaccgagatcaag
aagcttgacgacgaagccaaaaaccccaaagctggttctaaaatggtcgtcaacaccgaa
tggggcaacgttgacaacgccagaagtgtgttgccgataactgaatgggatgatattgtc
gactctgcgtcgatcaatccacgcagacagtctttcgaaaaacttatctcgggtatgtac
ctaggtgagatattgcggaggctgctggtggatctgcacgccaagcaagagtttctcagc
aacacgagcacgcttccggaggcttttaacacgcagtacgggctagacacggctctcatg
tctgattctctcagagactcagacggtgagaccacacatacgaagcaggtgctgggtgca
ttaggcgtatctgcagaaaatgttcgcgagctggatgcgcagcttttcagagatgcttcg
caactgatcgggttgcgcgctgccagattcagtgcgtgtgctctcgcagccgtgatcgag
tcagaggcgagtgagaacgccgcgggagatatcaacattgggctggatggatctgtcatc
gagttcttcccgagattcgaacaatctatccgggatgctctcaacgtcattctcggcaac
caggctgaaaaacgtatcaaaattggactggctaaggatggaagtggagtgggagctgct
ctatgcgccttgcaagctattaagcagggagttgcgaagaaatag

DBGET integrated database retrieval system