KEGG   Wenzhouxiangella marina: WM2015_1720Help
Entry
WM2015_1720       CDS       T04011                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
wma  Wenzhouxiangella marina
Brite
Enzymes [BR:wma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     WM2015_1720
Lipid biosynthesis proteins [BR:wma01004]
 Acyl-CoA synthetase
  Unknown
   WM2015_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2071173..2072966
Genome map
AA seq 597 aa AA seqDB search
MQHPTPTNHSLPLKTSGFRSLAEALDYAAGGETGCNFYNGRGELTEALTYAELREQALEL
ASRLHALGLERGARVALVADTHPHFHVFFFACQYAGLVPVPLPAAVHLGGREAFVAHLRA
MLVDSQARVAFAPDSFAAFLAEASEGLELEVSGTLADFADLPRAERLPEPPAPEELAYLQ
YTSGSTRFPRGTMITQRAVLANLAGILQFGVQIRRGDRFTSWLPYYHDMGLVGLILGPLV
SQLSVDYLGTRDFAMRPRVWLKLMSANRSTISFSPPFGYALCARRVRASDLDRFDLSSWR
VAGVGAEMIRASWLKRFADALAPAGFSPAAFLPCYGMAECSLAVSFAPLGQGIDVDLLDA
DVLAQDRHARPASADLDDTRITEFVNCGRPLPDYEVEIRAADGSLVAERECGVIYLRGPS
VMSGYANNEEASREALSHDGWLNTGDVGYRAGDSLFITGRAKDLLIINGRNIWPQDLEEV
AEQQPEVRAEDASAFSIPGEDGTEVAVLVVQCRERDAFRQADLVERLKQRIQSEFGIACL
IELVPLHTLPRTSSGKLSRSGARLDFLRRNGLESRPVLSQELVDRTPHTDAVETSRG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcctacgccgaccaatcattccctgcccctcaaaacctccggattcagaagc
ctcgccgaggccctggactatgccgcgggcggggagacgggttgcaacttctacaatgga
cggggcgagctgaccgaggcgctgacctacgccgagctgcgtgagcaggccctcgaactc
gcttcccgtttgcatgcgctcggattggagcgcggcgcgcgggttgcactggtggcggat
acccatccgcatttccacgtctttttcttcgcctgccagtacgcaggcctggttcccgtg
cccctgccggccgccgtgcacctcggcggccgggaagccttcgtcgcccacctgcgagcc
atgctggtcgactcccaggcgcgcgtggcctttgctcccgacagcttcgccgccttcctg
gccgaagcctccgagggcctggaactcgaagtctcgggcaccctcgccgatttcgccgat
ctgccgcgcgccgagcgactgccggagccgcccgcgcccgaagaactggcctacctgcag
tacacctcgggcagcacccgctttccccgcggcacgatgatcacccagcgggccgtgctg
gccaatcttgccggcatcctgcagttcggggtccagattcgccggggcgaccgcttcacc
tcctggctgccctactaccacgacatgggcctggtcggcctgatcctcggcccactggtc
tcccagctgtccgtggactacctcggcacgcgcgacttcgccatgcgtccgcgcgtctgg
ctgaagctgatgtcggcgaaccgttcgaccatttccttcagcccgccgttcggctacgct
ctgtgcgcccgtagagttcgcgcgagcgatctggatcgcttcgacctgagctcctggaga
gtcgccggtgtgggtgcggagatgatccgcgccagctggctgaaacgattcgccgatgcg
ctggccccggccggcttctcgccggcggccttcctgccctgctatggaatggcggaatgc
tccctcgcggtcagcttcgcacccctgggccagggcatcgacgtcgatctcctcgacgcg
gacgtcctcgcccaggatcgtcacgctcgtccggccagcgcggacctggacgacacgcgc
atcaccgagttcgtcaactgcgggcgccccctgccggactacgaagtcgagattcgcgcc
gcggacggttccctcgtcgccgagcgcgaatgcggcgtgatctacctgcgcggccccagc
gtcatgagcggctacgcgaacaacgaggaagccagccgcgaagcgctgagccacgatggc
tggctgaacacgggcgatgtcggctaccgtgccggcgacagcctgttcatcaccgggcgc
gccaaggacctgctgatcatcaatggccgcaacatctggccgcaggacctcgaggaagtc
gccgaacagcagcctgaagtgcgcgccgaagacgcttcggccttttcgatccccggtgaa
gacggcaccgaagtcgccgtgctggtcgtccagtgccgagagcgcgacgccttccgccag
gccgatctcgtcgagcgcctcaagcagcgcatccagtccgagttcggaatcgcctgcctg
atcgagctggtgcccttgcataccctgccacgcacctcctccggcaagctgtcgcgaagc
ggcgctcgcctggacttcctgcgtcgcaacggcctcgaatcccgcccggtgctgtcccag
gaactggtcgatcggacgccccacaccgacgcggtcgaaacttcccgcggctga

DBGET integrated database retrieval system