KEGG   Wenzhouxiangella marina: WM2015_2170Help
Entry
WM2015_2170       CDS       T04011                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
wma  Wenzhouxiangella marina
Pathway
wma00620  Pyruvate metabolism
wma00680  Methane metabolism
wma01100  Metabolic pathways
wma01120  Microbial metabolism in diverse environments
wma01200  Carbon metabolism
Module
wma_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:wma00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WM2015_2170
  Energy metabolism
   00680 Methane metabolism
    WM2015_2170
Enzymes [BR:wma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WM2015_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKS42533
UniProt: A0A0K0XXX3
LinkDB All DBs
Position
complement(2590873..2593563)
Genome map
AA seq 896 aa AA seqDB search
MKRDQIDFPPRHEPLREDVSLLGRMVGDLLREQCGEELFLRVERARAAAIERRLGEPGGD
RLGELCRFERFGAATDFVRGFAAWFRMVNLAEQVHRIRRRREYQAEGAGIQPESLADVFT
RLRESGTTWDEVRAMLDELLIEPVFTAHPTEATRRSVLEKEQRMARYLIQRLDPGLPASE
VRRLLDRVRMEQTIAWQTAEQSHERPTVADEAEHAHFYLANVLYRIAPVFHEHLAEAAST
AFGAEVWPGDLPTVLRFGSWVGGDMDGNPNVNAGTVLETLAEQRRQVIGNYRREAGKLNR
LLSQTDGRVGITDALNERIEVYRSRLKEVAESIPARHRDMPYRVFFYFIDARLAATLADD
ELAYESPEELVRDLGLVTESLQRHRGRHAGLFPVQRLRRRVDMFGFHLAALDLRIDSGDL
HQAVARQLGEADWPELPVETRIERLIGLLSEGFEAREDDHPVLGLLQAAATAHERFGSKA
VGTLIVSMSRNADDVLAAWLMARAAGVEDGRLDLVPLFETVGDLQAAEGVMSGLLELPLW
RELLAKRGNRQTIMLGYSDSNKDGGMVASRWSLQDAQRRLVQLFQERGVGVIFFHGRGGT
VGRGGGKTHRAVLASPPGSVAGRLRLTEQGEVIHRKYALRPIAIRNLEQTAGAVIQASLR
PSMASERHSDWREAMARLASHARDAYRDLVYGRDDFADYFRAATPIDVIERMRIGSRPAS
RASKSGIEGLRAIPWVFAWGQSRHALPGWYGLGSGLERLEGEIGAEALQTMARDWLFLSN
LLEDAEMAMAKADLSIARLYAGLAGELGKRYFPRIEEEFARTEAMICRLKGQRALLDRDP
TLKRSILLRNPYVDPMSFTQVDLLGRWRAGGREDGELEQALIASVHGIAQGLQNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgatcagatcgattttccgcctcgccacgaacccctgcgcgaggacgtctcc
ctgcttggccggatggtcggtgacctgctgcgcgagcagtgtggcgaggaactgttcctg
cgcgtcgagcgggcccgagccgccgccatcgagcgccgcctgggcgagccggggggcgac
cgcctgggcgagctctgccgcttcgagcgtttcggtgcggccacggatttcgtgcgcgga
ttcgcggcctggttccggatggtcaacctggccgagcaggttcaccgcatccgccgccgg
cgcgaataccaggccgaaggggcgggcatccagccagagagtctggcagacgtgttcacc
cgtctgcgcgagtccgggacgacctgggacgaggtgcgggcgatgctcgacgagctgctg
atcgagccggtcttcacggcccatccgaccgaggccacgcggcgctcggtgctcgagaag
gagcagcgcatggcccgctatctgatccagcgcctcgacccgggtctgccggccagcgag
gtccggcggctcctcgatcgggtgcgcatggagcagaccatcgcctggcagacggccgaa
cagtcgcacgaacggcccaccgtggccgacgaggccgagcacgcacatttctacctggcc
aacgtgctgtatcggatcgcgccggtgtttcacgagcacctggccgaagcggccagtacc
gccttcggcgccgaagtctggccgggtgatctgccgacggtgctgcgcttcggctcctgg
gtgggcggcgacatggacggcaaccccaacgtcaatgcgggcaccgtgctcgagaccctg
gccgagcagcgccgacaggtgatcggcaactatcgccgcgaggccggcaagctcaatcgc
ctgctcagccagaccgacgggagggtcgggatcacggatgccttgaacgagcgcatcgag
gtgtatcgatcgcgcctgaaagaggtggcggagagcatcccggcccggcaccgcgacatg
ccctatcgcgtgttcttctatttcatcgatgcgcggcttgcagcgaccctggccgacgac
gagctggcctatgaaagcccggaggaactggtccgggacctgggcctggtcacggagagc
ctgcagcggcatcggggccgccacgccggcctgtttccggtccagcgcctgcgccgtcgg
gtcgacatgttcgggttccatctggccgccctcgacctgcgcatcgattccggcgatctg
caccaggccgtggcgcgacagctcggtgaagcggactggccggagctgccggtcgagacg
cggatcgaacgactgatcggtttgctgagcgaaggcttcgaggcgcgcgaggatgatcat
ccggtgctgggtctgctccaggccgcggccacggcgcatgagcgtttcggctccaaggcc
gtcggtaccctgatcgtgagcatgagccgcaacgccgacgacgtgctcgcggcctggttg
atggccagggcggcgggcgtcgaagacgggcgtctggacctggtgccactgttcgagacc
gtcggggatctgcaggcggccgaaggcgtgatgtccgggctgctcgaactgccgctctgg
cgcgagctgctcgccaaacggggaaatcggcagacgatcatgctcggctattccgacagc
aacaaggatggcggcatggtggcctcgcgctggtccctgcaggacgcgcagcgtcgcctg
gtccagctgttccaggagcgcggcgtgggcgtgatcttcttccacggccggggcggcacc
gtcggtcgcggcggtggcaagacccaccgcgccgtgctggcctcgccgccggggtcggtg
gccgggcgcctgcgactgaccgagcagggcgaggtgattcaccgcaagtacgctctccgt
cccatcgccatccggaatctggagcagaccgccggcgccgtcattcaggccagcttgcgc
ccatcgatggcctcggagcgccattccgactggcgcgaggcgatggctcgtctggccagc
cacgcccgcgacgcctaccgtgatctggtctacggacgcgacgacttcgccgactacttc
cgcgctgccaccccgatcgacgtgatcgagcgcatgcgcatcggttcgcgaccggcctcg
agagcgagcaagtccgggatcgagggcttgcgcgcgatcccctgggtctttgcctggggc
cagagccgccacgccctgccgggctggtacggtctgggcagcgggctcgagcgcctggag
ggggagatcggcgccgaggccctgcagaccatggctcgggactggctgttcctgtcgaac
ctcctcgaagacgcggaaatggccatggccaaggcggatctgagcattgctcgcctgtat
gccggcctggccggtgagctgggcaagcgctacttcccgcggatcgaagaggaattcgcg
cgcacggaagccatgatctgtcgcctgaagggccagcgggccctgctggatcgagacccg
acgctgaagcgctcgatcctgctgcgtaacccctacgtcgacccgatgagcttcacccag
gtcgacctgctcggccgctggcgggccggcggtcgcgaagacggggaactggaacaggcc
ttgatcgccagcgtccacggcatcgcccagggcctgcagaacacgggctga

DBGET integrated database retrieval system