KEGG   Woeseia oceani: BA177_09175Help
Entry
BA177_09175       CDS       T04427                                 

Definition
(GenBank) hypothetical protein
Organism
woc  Woeseia oceani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2055702..2057645
Genome map
AA seq 647 aa AA seqDB search
MTQFSTLSEMLLARRASTHRLNFIDSDNPEHSVSFSELVDSALGCLKSLQDRGFSAGDEL
VIFTDSNEQFLIAFWAAILGGLIPVPVAVGISDEHRMKLFKILRQLRNPSIFSNDNLQER
LRTFATEQKLDDILQLLAERSVSSDELDYTGEGAVHTPTEDDLAFIQYSSGSTSDPKGVC
LTHRNLCSNTRDIINSLSLNENERSLSWMPLTHDMGLIGYHVSMITANMNHAIMDTSVFV
RRPLLWLQKVSELGSTVLCSPNFGYKHYLKVFERKGPGDIDLSKVRLLLNGAEPISVALC
DEFLDALEPHGLRREAMLPVYGLAEATLAVAIPELGNRYSWITVDRHSLRIGKPYVELTG
ADADSENAVKLVKHGGIVEGCELRIADDADLALPEGYVGHIHLRGPNITGGIFGDKDDTA
GIHTPDGWLRTGDCGAMADGQLLITGRHKEIIIVNGQNYLPHDIEEVVATLDDLDIGKVV
ACGALPANSQVEQLIVFILHRKDAESFATIAEQVRSIVGRQIGIEVDYVLPVSRIPKTTS
GKIQRRLLAQEFLDGAFAEQIAAQKKLAPAEPDADEDPLVREILGICAEFSRDKVVGPDD
NLFEVGISSLTLTEIMLAVDEKYPGKVDINDLFDYPTIRELAQFLQR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgactcaattttccacgctcagcgagatgctgctcgcccgtcgcgctagtacgcatcgc
ctgaatttcatcgatagcgataatccggaacacagcgtgtccttcagcgagctcgttgat
agtgcgctcggttgtctcaagtcgctgcaggaccgcggattcagcgccggcgacgagctg
gtcatcttcactgacagcaacgagcagtttctcatcgcattttgggcggccatcctcggc
ggcctcattcccgttccggtcgctgtaggtatcagcgacgaacatcgaatgaagttgttc
aaaatcctgcgtcagttgcgcaatccctcaattttcagcaacgacaatttgcaggagcga
ctgcgaacattcgcaactgaacagaaactcgacgacatactgcaactactcgccgaacgc
agcgtctccagtgacgaactcgattacacaggcgagggcgcagtgcatacgccaacagag
gatgacctggcgtttatccagtattcgtcgggttcaaccagcgacccgaaaggcgtttgc
ctgacccatcggaatctgtgcagcaatactcgcgacatcatcaacagcttgtcactgaat
gaaaacgagcgctcgttgagctggatgccgttgacgcacgacatgggcctgattggctat
cacgtatccatgattacggcgaacatgaatcacgcgattatggatacaagtgtgttcgta
aggcggccattgctctggctgcaaaaggtgagtgaactcggctcgacggtgctctgctcg
ccgaattttggttacaagcattacctgaaagtgttcgaacggaaaggtcctggcgatatc
gatctgtcgaaggtccgcctgctgctgaatggcgcagaaccgatttcggtggcgctgtgc
gacgagttcctcgacgcactcgaaccgcacgggctgcgacgtgaagccatgttaccggtg
tacggtcttgcggaagccacgctggcagtcgccataccggagctgggcaatcgttattcc
tggatcactgttgatcgacacagtctccgcataggtaagccgtacgtggaactcacgggc
gcggacgctgactcggaaaacgccgtcaagctggtcaaacacggcggtatcgtcgagggc
tgcgagttgcgcattgcggacgatgccgacctcgcattgccggagggctatgtaggccat
atccacttgcgtggcccgaatattaccggcggaattttcggcgacaaggacgatacagca
ggcatccacaccccggatggctggctgcggactggcgactgtggtgcgatggcggacggc
cagttgctgattaccggccggcacaaagaaatcatcattgttaacggccaaaactacctg
ccgcacgatatcgaagaggtcgtggcgacactcgacgatctcgacatcggcaaagttgtg
gcctgtggagccttacctgccaacagccaggttgagcaactcatcgttttcatcctgcat
cggaaagatgccgaatcgttcgccaccattgcggaacaggtgcgcagtatcgtcggccgt
cagatcggtatcgaggtcgattacgttctgcccgtttcccgtatccccaagaccacgagt
ggcaaaattcagcgccgattgctcgcgcaggaattcctggacggtgcgttcgcggaacaa
atcgccgcacagaaaaagctggcgcctgcggagccggatgctgatgaagatccattggtc
cgtgaaatactcgggatatgcgccgagttttccagggacaaagtggtcgggccggacgac
aatcttttcgaggttggcatcagctcattgacgctcaccgaaatcatgctcgcggttgat
gaaaaataccccggcaaggtcgatatcaacgacctttttgattaccccactattcgcgag
cttgcgcagttcttgcaacgctga

DBGET integrated database retrieval system