KEGG   Woeseia oceani: BA177_18120Help
Entry
BA177_18120       CDS       T04427                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
woc  Woeseia oceani
Brite
Enzymes [BR:woc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BA177_18120
Peptidases [BR:woc01002]
 Metallo Peptidases
  Family M2
   BA177_18120
Exosome [BR:woc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BA177_18120
CD molecules [BR:woc04090]
 Proteins
  BA177_18120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4033084..4034877
Genome map
AA seq 597 aa AA seqDB search
MLSLLLSLAACDVDVAVDATAQADESPDEFVARLNTELAELGRQNGAANWVRATYINHDT
AILAAAAGERYSAWHSKSVAESLKFSDADMSADTARSIKQLKLGTSEPAPNDPAKRRELA
AIMTDMSGMYGAGKYCPDDGRECMSLNELENVLAASRDYDAQLDAWQGWREVAKPLREKY
ARFVELSNEGANELGYGDLGQLWRDGYDMSPAEFEAETARLWQQVKPLYDALHCHVRAEL
AEEYGADKVPLDGPIPAHLLGNMWAQEWGEIYDLLEPYPGVGDLDVDSALIEQAYTPVRM
VESAEQFYVSLGFEKLPATFWERSMFVKPADREVVCHASAWGLDGGDDLRIKMCIEPAYE
DLRVIYHELGHNFYQRAYKDQPRLLQGGAHGGFHEAIGDTITLSMTPGYLAEVGLIESAE
TSEEAVINRQMQQALDKVAFLPFGKLIDEWRWDVFAGKTSPDNYNKAWWELRTRYQGIAP
TSERGEDYFDPGAKYHVPGNTSYTRYFLARILQFQFQRSLCEAAGFNGPLHECSVFGSKE
AGERLQAMLAAGASRPWQETLEKLTGTREMDATAIIDYFEPLMSWLEVQNEGRSCGW
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ctgttatccctgctgctgtcactcgcggcctgcgacgtcgatgtcgctgttgacgctacg
gcacaagccgacgagtccccggatgaattcgtcgcaagactcaacaccgagctcgcagaa
ctggggcgccagaacggtgccgcgaactgggtgcgagcgacttatatcaatcacgacacg
gccattctcgccgcggcagctggcgaacgttactcggcgtggcacagcaagagcgttgcg
gaatcattgaagttcagcgatgccgacatgtcggccgatacggcacgctctattaaacaa
ctcaaacttggcacgtcggaaccggcaccgaatgatccggccaaacgccgcgaactggcc
gcgatcatgaccgacatgtccggcatgtacggggcaggtaaatattgccccgacgacgga
cgcgagtgcatgagcctcaatgaactcgagaatgttctggccgcaagccgcgactacgac
gcgcagctggatgcctggcagggttggcgcgaggtcgcaaaacctttgcgcgaaaaatac
gcgcgcttcgtagagttgagcaatgaaggtgccaacgagctgggttacggcgatctgggc
cagctgtggcgtgacggctacgatatgtcgcccgcggaattcgaggccgaaacagcgcgc
ctgtggcagcaggtaaagccgctgtacgacgcgctgcattgccacgttcgtgcagagctg
gccgaggaatacggcgcagacaaggtgccgctggacggcccgataccggcgcatctgctc
ggcaacatgtgggcacaggaatggggagaaatttacgacctgctggaaccttatcccggg
gtaggtgatctggacgtggacagcgccctcatcgaacaggcgtacacgccggtcaggatg
gttgagtctgccgaacaattttatgtatcgctcggtttcgaaaaattgccggcgacgttt
tgggaacgctccatgttcgtaaaaccggcggaccgggaagttgtctgccacgccagcgcc
tggggtctcgacggcggcgatgatctgcgcatcaagatgtgcatcgaaccggcctacgaa
gacctgcgggttatttaccacgagctcggccacaacttttatcaacgcgcttacaaggac
cagccgagattgctgcaaggcggcgcgcacggcggcttccacgaggccatcggcgacacg
atcaccctgtcgatgacgccgggctacctggccgaggtcggtctgatcgaatccgccgag
accagcgaagaagccgtgatcaaccggcaaatgcaacaagcgctcgacaaggttgcgttt
ctgccgtttggcaagctgatcgatgaatggcgctgggatgtatttgccggcaagacctcg
cccgacaactacaacaaagcgtggtgggagttgcggactcgctaccagggcatcgcgccg
accagcgagcgtggcgaagactattttgacccgggtgccaagtatcacgttccgggcaac
acctcgtatacccgctatttcctggcgcggatactgcagttccagttccagcgttcgttg
tgcgaagcggccggcttcaatggccccctgcacgaatgctcggtctttggcagcaaggaa
gcgggcgagcgactgcaagccatgctcgccgccggcgcaagtcggccgtggcaggaaacc
ctggaaaaactcaccggtacccgggaaatggatgccacagccatcattgattactttgag
ccgttgatgagctggctggaagtacagaatgagggtcgcagctgcggctggtaa

DBGET integrated database retrieval system