KEGG   Weissella paramesenteroides: CO680_01320Help
Entry
CO680_01320       CDS       T05120                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wpa  Weissella paramesenteroides
Pathway
wpa00473  D-Alanine metabolism
wpa00550  Peptidoglycan biosynthesis
wpa01100  Metabolic pathways
wpa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wpa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CO680_01320
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CO680_01320
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CO680_01320
Enzymes [BR:wpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CO680_01320
Peptidoglycan biosynthesis and degradation proteins [BR:wpa01011]
 Precursor biosynthesis
  Amino acid ligase
   CO680_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ATF40777
LinkDB All DBs
Position
260903..262051
Genome map
AA seq 382 aa AA seqDB search
MSEKLNIAMLFGGNSSEHDVSKRSAHNIYDAMDKEKYNVTVFLISKDGIMINAEDSWRVF
EGEDEDEIVAAAKEKMDLSNPLAPIAVLGEMANIDFFYPVVHGNLGEDGTLQALFRLLKK
PYLGPGIAASAMSFDKDLTKRILNQAGVRNTNYVLLTDQNYQDYTYDELVKELDSEVLFV
KAASQGSSVGVSRVTNEDEYKAALKDSFQYDYKILVEGALDKPREVFISILGNENPRASR
LGGIVLPEEDVWYDYNNKFVDASGMVFELPVELDQALTDEITDMALRAYKALGLVGLTRM
DFMIDKNGVPYLGEPNTLPGFTNISLYPQMWEVSGISYTHLIDELIAYGIAEFDRQNKLS
YDFVSLGEEQMGEKKYNAEVAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaattaaatattgcaatgttgtttggtggtaactcatcagagcacgatgtt
tcaaagcgttcagctcataatatttatgatgctatggacaaggagaaatacaatgtcaca
gtctttttgatttcaaaagacggtattatgattaatgctgaagactcatggcgtgttttc
gaaggcgaagatgaggatgaaatcgtagcggcagctaaggagaagatggacctatctaat
ccgcttgcaccaattgctgttttgggggaaatggccaatattgatttcttctacccagtt
gtccatggaaacttgggtgaggatggaacactacaagcgctattccgcttgttgaaaaag
ccttacttaggacctggtattgcagcttcagccatgtcatttgataaagacttgacgaaa
cgaattttgaaccaagctggtgtgcgtaatacaaactacgtactattaactgatcaaaat
tatcaagattacacttacgacgaattagttaaggaactggattcagaagttttgtttgtt
aaggcagctagtcaaggttcatccgttggtgtgtctcgtgtaaccaatgaagatgagtac
aaggcagccttgaaggattcattccaatatgattataaaatcttagtggaaggtgctctt
gataagcctcgtgaggtatttatctcaatcttaggtaacgagaatccacgtgcttcacgc
ttaggtggtattgtactaccagaggaagatgtttggtacgattacaacaataagtttgtt
gacgcttcaggtatggtatttgagttacctgttgaattggatcaagcactaactgatgaa
attaccgatatggccttgagggcttacaaggctcttggattagttggattgacacgtatg
gacttcatgattgataagaatggggtgccataccttggtgagcctaacacattacctgga
ttcactaatatttcattgtatccacaaatgtgggaagtttctggcattagctatacacat
ctgattgatgaactaattgcatatggtatcgctgaatttgaccgtcagaacaagttgtca
tacgactttgtttctcttggcgaagaacaaatgggtgaaaagaagtataatgctgaagta
gctaaataa

DBGET integrated database retrieval system