KEGG   Wallemia mellicola: WALSEDRAFT_18512Help
Entry
WALSEDRAFT_18512  CDS       T03142                                 

Definition
(RefSeq) heme peroxidase
Organism
wse  Wallemia mellicola
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MAPNDKNKQSLLKPVWNLLGNLKSQIAQGKFFQDVGVLHDLLKTAANGGAQNDREFLLER
MVGILSTIPSTPENDRLTGKFIQMLWQDLPHPPLNYVGDVPFNGNEHVSGSLRIRHADGS
LNNPFLPSLGKANTPYARNVALKHVYTQPLPSEEDVFNKLLRRKEGDFLAHPTGLSSLFF
NFATCVIHTIFRTDTKNSAVNGTSSYMDLAIVYGNNVEEEHSVRSFENGHLKPDTISESR
LFMMPPAITTLLILLNRNHNYICENIFRENEKKWYKPWAELDDENKKKQDEDIFHTAKLI
NCGFFANIVLHDYLRAILGLTRSKSTWVLDPRAEVHNMGQPPLETGTGGAVSIEFNVLYR
WHSVLSKSDTEWTENFFKKMFGDDVDFDKITPREFGQKAYGLIQASGNEPSERNIPGLSR
QENGTFKNEDLVGVLKQAIDEPAGSFRARGTPSVLRVVDIMGMKQAREVWGLCTMNEFRK
AMSLTQFKSFEEWNSDKEVAQAARELYGHIDNLELYPGLLAEEQKPPIEGSGLCPGYTVS
RAILSDAVSLVRGDRFLTNECTPQALTTWGYNYIQPDNSNKAFGGMLVTLLENTLPNTLD
KDSVYALFPFNTPETMKKNLTKLKIEKEYKFTTN
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaacgataagaacaaacaatctttactcaagcctgtttggaacttattgggt
aaccttaaatcacaaatcgcccaaggcaagttcttccaagatgttggcgtacttcacgat
cttttgaagactgcagctaacggcggtgcacaaaatgacagagaatttttgttagaaaga
atggttggtattctctcaactattccatctacaccagagaatgatagactcaccggtaaa
ttcattcaaatgctctggcaagatcttccacatccaccattaaactacgttggtgatgtt
ccattcaacggtaacgagcacgtatcaggtagtctccgtatcagacatgccgatggttca
ctcaacaacccattcttaccttcattgggtaaagcaaacactccatatgctcgtaacgtt
gccttgaagcatgtctacactcaaccactcccttctgaggaagacgtcttcaacaagctc
ctccgtagaaaggaaggtgacttcttggctcacccaactggtttgagctcacttttcttt
aacttcgctacatgcgtcatccacactatcttcagaacagacaccaaaaactcagctgtt
aacggtacttcatcttacatggatttggctattgtatacggtaacaacgttgaagaagaa
cactccgttcgttcattcgagaacggtcatcttaaaccagataccatttctgagtcaaga
ttgttcatgatgccaccagcaattaccacacttctcattttattgaacagaaaccacaac
tacatctgtgagaacatcttccgcgaaaacgagaagaagtggtacaaaccatgggcagaa
cttgacgatgaaaacaaaaagaaacaagatgaggacatcttccacaccgctaagctcatc
aactgtggtttcttcgccaacattgtcttacacgattacttgagagctatcctcggtctc
acacgttcaaagtcaacctgggttctcgatccacgtgcagaagttcacaacatgggtcaa
ccaccactcgaaactggtactggtggtgctgtctctattgaattcaatgttctttacaga
tggcactcagttctgtcaaaatctgacacagaatggactgagaacttcttcaagaagatg
tttggtgatgatgttgactttgacaagatcactccaagagaatttggtcaaaaggcttat
ggtttaattcaagcttctggtaatgaaccatccgagcgtaacattccaggtctcagccgt
caagaaaatggtaccttcaagaatgaagatctcgttggtgttttgaagcaagctattgat
gagccagctggttcattcagagctagaggtacaccatctgttctccgtgtcgttgatatc
atgggtatgaaacaagcacgtgaagtttggggattatgtacaatgaatgaatttagaaag
gcaatgtcattgactcaattcaagtccttcgaagagtggaacagtgacaaggaagtcgct
caagcagctcgtgaattgtatggacacatcgataacttggagttatacccaggtttatta
gctgaagagcaaaaaccaccaatcgaaggatcaggtttgtgtccaggatacacagtctca
agagctatcttatcagatgccgtttcactcgttcgtggtgacagattcttgactaatgaa
tgcacacctcaagcattgactacatggggttacaactacattcaaccagataacagcaac
aaggcattcggtggtatgcttgtcacactccttgaaaacactcttccaaacactcttgat
aaggattcagtttacgctcttttcccattcaacactcctgagacaatgaagaagaacttg
actaaattgaagattgagaaggaatacaagttcactaccaattag

DBGET integrated database retrieval system