KEGG   Wallemia mellicola: WALSEDRAFT_32728Help
Entry
WALSEDRAFT_32728  CDS       T03142                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
wse  Wallemia mellicola
Pathway
wse00250  Alanine, aspartate and glutamate metabolism
wse00280  Valine, leucine and isoleucine degradation
wse00410  beta-Alanine metabolism
wse00640  Propanoate metabolism
wse00650  Butanoate metabolism
wse01100  Metabolic pathways
Module
wse_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:wse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    WALSEDRAFT_32728
   00650 Butanoate metabolism
    WALSEDRAFT_32728
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WALSEDRAFT_32728
   00280 Valine, leucine and isoleucine degradation
    WALSEDRAFT_32728
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WALSEDRAFT_32728
Enzymes [BR:wse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WALSEDRAFT_32728
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     WALSEDRAFT_32728
Amino acid related enzymes [BR:wse01007]
 Aminotransferase (transaminase)
  Class III
   WALSEDRAFT_32728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 18471550
NCBI-ProteinID: XP_006958629
JGI: Walse1_32728
UniProt: I4YBD4
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MKSTFIRRFATLRPEIVTKSFPGPVSKSISKDISEIQEDRAHQFIVDYGKSSGNYIVDAD
GNTLLDAFAQIASIAIGYNNPALIELAKSEEFITAAINRPALGNFPPSNWKQILEDGLLK
KTPKGLEQLFTAMCGSCANESAYKAVFMAYRDKHHGTGFSEEELKSCMQNAAPGSPEYSI
LSFESAFHGRLFGSLSTTRSKAIHKIGVPAFDWPQVAWPAVKYPLEEYGDYNRAAEAKSL
ELVRQTIREHKTKKPVAALVVEPIQSEGGDNHASADFFRGLREITKEEGVYMIVDEVQTG
FGATGSFWAHDKWNLETPPDIVTFSKKAQAAGFYHNFDLRPSLPYRNFNTWMGDPIRALQ
AREMIKYIDNHNLVKHTEDVGEFIYTSLKNLSGNTPIENVRGWKQGTFISFDMPTSQGRD
LVVSSMRARGVNIGGCGERAVRLRPMLIFGKEEAGILLDTLRKVIADI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtacatttattagacggttcgcaacactcagacctgagattgtaacaaaaagc
ttccctggaccggtttctaagtcgatatctaaggatatttcagaaattcaggaagataga
gcacatcagttcatagttgattacggtaaaagctctggtaactacattgtagatgctgat
ggtaatacactgctcgatgcatttgcacagattgcttcaatcgcgataggatataacaac
ccagctttgattgaactcgctaaatctgaagagttcatcacagcagcgataaacagacca
gctttgggtaacttccctccatcgaactggaaacaaatactcgaggatggattactcaag
aagacacctaaagggctcgaacaactcttcaccgcaatgtgtggatcctgcgccaacgaa
tccgcatacaaagcagttttcatggcctatcgcgataaacaccacggaactggtttcagt
gaggaagaactaaaaagctgtatgcaaaatgccgcaccaggttcaccagaatattctatc
ctctcttttgaatcagctttccatggtagattgttcggctcgctctcaactacacgctcc
aaagctatccataagatcggcgtacctgcatttgattggccgcaagttgcctggccggct
gtcaaataccctcttgaagaatatggggactataatagagcagctgaagctaaatctcta
gaattggtgagacagactatacgtgaacacaaaaccaagaaaccggtagcagcactcgta
gtcgagccaatccaatcagaaggtggagataaccatgcctctgcagatttctttagaggt
ttgagagaaatcaccaaagaggaaggcgtctatatgattgttgatgaagtacagactggg
ttcggtgctactggttcattctgggctcatgacaagtggaacctcgagacaccaccagat
atcgtcactttctctaagaaggcccaagctgctggtttctaccacaactttgacttacgt
ccttcattaccatacagaaacttcaacacctggatgggtgatccaattagagccttacaa
gcaagagagatgataaaatatatcgataatcacaatcttgtcaagcatacagaagatgtt
ggagagttcatctacacttctctcaagaacctcagtggaaacacaccaattgaaaatgtc
agaggctggaaacaaggtacattcatatcgttcgatatgccaacatcgcaaggaagagat
ctcgttgtgtctagtatgagagctagaggtgttaacattggaggatgtggtgaaagagct
gtgagattaagaccaatgcttatatttggtaaagaagaagcgggaatattacttgacaca
ctaagaaaagtaatcgctgatatctga

DBGET integrated database retrieval system