KEGG   Xanthomonas citri pv. citri 306: XAC1217Help
Entry
XAC1217           CDS       T00084                                 

Definition
(GenBank) dipeptidyl carboxypeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
Enzymes [BR:xac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XAC1217
Peptidases [BR:xac01002]
 Metallo Peptidases
  Family M2
   XAC1217
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC1217
CD molecules [BR:xac04090]
 Proteins
  XAC1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1394452..1396470)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVATGTLSLSACRRDAAPPDKPVATKTAPAESADQFVARISAEYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNASGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEASQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSDWLKQQNQGQMCGWQATAAA
PVTTKTAPAAAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcattggctgtggctaccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacaaacctgtcgcgaccaagaccgcgccggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
accaccgctgcgcagtggctgtcgtccacctatatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagctggatcggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcagttgctcaaattgatg
agcgccctgcccgcaccgcgcgaccctgccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgccggcagctattgcgtgggcgaaggcgagcagcgccgc
tgccgccagctgggcgagttggagcaagtgctggccagcagccgcgactacaacgagcaa
ctcgacgcatggcagggctggcacagcactgcgcaacccatgcgcaaggactaccaacgc
ttcgtcgagctggccaatgagggcgcacgcgggctgggtttcgccgacgtcggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctatgg
gaacaggtcaaaccgttgtatgcgcagttgcagtgctatgcgcgcggcaaactcgacacg
caatacggcaaagacaagggcgaggtcgccggcggcctgttgccggcacatctgatgggc
aatatgtggcagcaggactggagcaatctgtgggatctgctgcagccctacccgggggcc
ggcgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcaccgcagtg
ctggcacgcaacgccagtggcgatggtggcgcggccgcacgcttcaacgccgaacgcgaa
gcgcagctgcgcaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacctattggcagcgctcgcagttcatcaagccgctggac
cgcgacgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgaggcgagccag
aacatcggcgcggatgtgcgcaccaagatgtgcatcaaaccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcctacaacccgttaccgccg
ctgttccagaacggcgccaacgatggcttccacgaagcgatcggcgacaccatcgtgctg
gcgatgacgcccaaatacctgcaatcgatcggcatggtgggcgagcaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggcgctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactcaaagccaagtaccagggcgtggcgccggtgagcgcg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacaccccgtac
acgcgttattttctggcgcatatcctgcaattccagttctacaaaggcctgtgccaggcc
gccggccatcaggggccgctgtacgagtgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcaacgtggttccagccaaccctggcaaaccacactcaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatacttcgcgccgatgagc
gactggctgaagcagcagaaccaggggcagatgtgcgggtggcaggcaacggctgccgct
ccggttacaacgaaaactgcgcctgctgcagctcgttga

DBGET integrated database retrieval system