KEGG   Xanthomonas citri pv. citri 306: XAC1461Help
Entry
XAC1461           CDS       T00084                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XAC1461 (gst)
Enzymes [BR:xac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XAC1461 (gst)
Transporters [BR:xac02000]
 Other Transporters
  Pores ion channels [TC:1]
   XAC1461 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1688667..1689290
Genome map
AA seq 207 aa AA seqDB search
MYHSPSTAALVVHWLLIELDIPHALHPLDFERGEHKSPQYLALNPAGVVPTLVLDGQVLT
EAAAIVLQLADLHPQAGLAPAVGTPERAAYYKWMFFCANTLQPAYRAWFYPSEPAGAGQA
EAAQMHARRKLEAAWTQVDAHLQAHGPYLLGKTVSAADFMLTMLMRWSRNMPRPTDTWPA
LRAHAMQMKARPAFQETYRREGLTDWT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccactcccccagcaccgcagcgttggtggtgcattggctgctgatcgaactggat
atcccgcacgcactgcacccgctggatttcgaacgcggcgaacacaaatcgccgcagtat
ctggcgctcaatccggccggcgtggtgcccacgctggtgctcgacggccaagtgctcacg
gaagccgcagccatcgtgctgcagctggccgatctgcatccccaggccgggctggccccg
gcagtcggcacgcccgagcgtgcggcgtactacaagtggatgttcttctgcgccaacacc
ctgcagccggcgtaccgcgcctggttctatccgagcgagcctgccggggccgggcaggcc
gaggcggcgcagatgcacgcccgccgcaagctcgaagcggcctggacccaggtcgatgcg
catctgcaggcccatggcccgtatctgctcggcaagaccgtgtcggcggccgatttcatg
ttgaccatgctgatgcgctggtcgcgcaacatgccgcggccgaccgatacctggccggcg
ctgcgggcgcacgcaatgcagatgaaggcgcgcccagcattccaggaaacctatcgccgg
gaaggcctgacggactggacctga

DBGET integrated database retrieval system