KEGG   Xanthomonas albilineans: XALC_0887Help
Entry
XALC_0887         CDS       T01160                                 

Definition
(GenBank) hypothetical conserved peptidyl-dipeptidase protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xal  Xanthomonas albilineans
Brite
Enzymes [BR:xal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XALC_0887
Peptidases [BR:xal01002]
 Metallo Peptidases
  Family M2
   XALC_0887
Exosome [BR:xal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XALC_0887
CD molecules [BR:xal04090]
 Proteins
  XALC_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1004534..1006498)
Genome map
AA seq 654 aa AA seqDB search
MNHRHPLLGLCIAASLLFLSACRKDAAPENVAPATPHAIGESADQFVARINEQYRKQLPE
LTTAQWLSATYINADTQRLASEANARWLTTLNGWIAQAKRYQGQPMSADSARALQRLKQM
TAMPAPHDPAKLNELTALAAKMEGAYAVATSCSGEGDARRCRQLDELEEVLRRSRDYDQQ
LDAWQSWHATAQPLRKDYPRFVELVNEGAREMGYADTGAMWRSGYDMPPAQLVAETDRLW
AQVKPLYEQLHCYARSKLDTEYGKDKGEVAGGLLPAHLLGNMWQQDWSNLWDLLQPYRDA
SNLDITDALERQYQSDLSAALARRNGDTSAEARFMAQREAQSLSARQMNEHAQDFYTSLA
MPKLPDSYWSRSQFIKPLDRDVDCHASAWNMDMAGDVRAKMCVKPDEEDFATLYHELGHV
YYYLAYDSLPPLFQSGANDGFHEAIGDTVVLALTPQYLHTIALTETPQVSREALINTQMR
MALNKVAFLPFGLMIDRWRWGVFDGSIGPDRYNQAWWELKAKYQGVAPVAPRGEAFFDPG
AKYHVPANTPYTRYFLSHILQFQFYKSLCDAAGHKGPLYACTFYGNKEAGQKFWSMLQRG
ASQPWQATLKELTGSERLDAGPLLEYFAPIQQWLKQQNQGRLCGWDTPKPTTAH
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaccgtcacccgctgctcgggctatgcatcgccgcgagcttgttgttcttgtcc
gcgtgccgcaaggatgccgcaccggagaatgtcgcgcccgccacgccacacgccatcggc
gaaagcgccgaccaattcgtggcccgcatcaacgagcagtaccgcaagcagctcccggaa
ctgaccacggcgcaatggctgtctgccacctacatcaacgccgatacgcagcggctggcg
tccgaggccaacgcgcgctggttgaccacgctcaacggctggatcgctcaggccaaacgc
taccaaggccagccaatgtcggccgacagcgcacgtgcgctgcaacgactcaagcagatg
accgcgatgcctgcaccgcacgacccggccaagctgaatgaactcactgcgctggctgcg
aagatggaaggcgcctatgcggtggctacatcctgcagcggcgaaggcgatgcgcgccgc
tgccggcaactggacgaactggaagaggtactgcgccgcagtcgcgactacgatcaacaa
ctggacgcctggcaaagctggcacgccaccgcacaaccgttgcgcaaggactacccgcgc
ttcgtcgaactggtcaacgaaggcgcgcgcgagatgggctatgccgacactggcgcgatg
tggcgcagcggctacgacatgccgcctgcacaactcgtcgccgagaccgaccggctgtgg
gcccaggtgaagccgttgtacgagcaattgcactgctacgcgcgcagtaaactcgacacc
gaatacggcaaggacaagggcgaagtcgctggcggcctgctaccggcacacctgctcggc
aacatgtggcagcaggactggagcaatctatgggacctgttgcagccctatcgcgatgcc
agcaatctcgacatcaccgatgcgctggagcgtcaataccagagcgacttgagcgcggca
ctggcgcggcgtaacggtgacacctcggcggaagcacggttcatggcacaacgcgaagcg
cagtcgctcagcgcccggcagatgaacgagcacgcacaggacttctacacctccctggcg
atgcccaagctacccgatagctactggagccgcagccagttcatcaagccactggatcgc
gacgtggattgccatgccagtgcatggaacatggacatggccggcgatgtgcgcgccaaa
atgtgcgtcaaaccggacgaagaagacttcgccaccctctaccacgaactggggcatgtc
tattactacctagcctacgactcgctaccgccactgttccagagcggcgccaacgacggc
ttccatgaggccatcggcgacaccgtcgtgctggcgctgacgccgcagtatctgcatacc
atcgccctgaccgagacgccgcaagtcagtcgcgaggcgctgatcaatacacagatgcgc
atggcgttgaacaaagtggcgttcttgccgttcgggttgatgatcgaccgctggcgctgg
ggcgtgttcgatggctcgatcggcccggaccgctacaatcaggcgtggtgggaactgaag
gccaaatatcagggtgtggccccggtcgcgccgcgcggcgaggcgttcttcgacccaggc
gccaagtaccacgtgccggccaacacgccgtacacgcgctacttcctctcacacatcctg
caattccagttctacaaaagcctatgcgatgccgccggccataaggggcctctgtacgcc
tgcaccttctacggcaacaaggaagccgggcagaaattctggtcgatgctgcaacgtggc
gccagccaaccctggcaggccacgctcaaggaactcaccggcagcgagcgcctcgatgcc
ggcccgttactggaatacttcgcaccgatccagcagtggctcaaacagcaaaaccaggga
cgtctgtgcggctgggacacccccaagccgacaacagcgcattga

DBGET integrated database retrieval system