KEGG   Xanthomonas axonopodis Xac29-1: XAC29_07370Help
Entry
XAC29_07370       CDS       T02500                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xao00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XAC29_07370
Enzymes [BR:xao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XAC29_07370
Transporters [BR:xao02000]
 Other Transporters
  Pores ion channels [TC:1]
   XAC29_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1691267..1691902
Genome map
AA seq 211 aa AA seqDB search
MVATLYHSPSTAALVVHWLLIELDIPHALHPLDFERGEHKSPQYLALNPAGVVPTLVLDG
QVLTEAAAIVLQLADLHPQAGLAPAVGTPERAAYYKWMFFCANTLQPAYRAWFYPSEPAG
AGQAEAAQMHARRKLEAAWTQVDAHLQAHGPYLLGKTVSAADFMLTMLMRWSRNMPRPTD
TWPALRAHAMQMKARPAFQETYRREGLTDWT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccacgttgtaccactcccccagcaccgcagcgttggtggtgcattggctgctg
atcgaactggatatcccgcacgcactgcacccgctggatttcgaacgcggcgaacacaaa
tcgccgcagtatctggcgctcaatccggccggcgtggtgcccacgctggtgctcgacggc
caagtgctcacggaagccgcagccatcgtgctgcagctggccgatctgcatccccaggcc
gggctggccccggcagtcggcacgcccgagcgtgcggcgtactacaagtggatgttcttc
tgcgccaacaccctgcagccggcgtaccgcgcctggttctatccgagcgagcctgccggg
gccgggcaggccgaggcggcgcagatgcacgcccgccgcaagctcgaagcggcctggacc
caggtcgatgcgcatctgcaggcccatggcccgtatctgctcggcaagaccgtgtcggcg
gccgatttcatgttgaccatgctgatgcgctggtcgcgcaacatgccgcggccgaccgat
acctggccggcgctgcgggcgcacgcaatgcagatgaaggcgcgcccagcattccaggaa
acctatcgccgggaaggcctgacggactggacctga

DBGET integrated database retrieval system