KEGG   Xanthobacter autotrophicus: Xaut_2530Help
Entry
Xaut_2530         CDS       T00581                                 

Definition
lysine--tRNA ligase
Orthology
K04568  
lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
xau  Xanthobacter autotrophicus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:xau00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2827403..2828494)
Genome map
AA seq 363 aa AA seqDB search
MAVSTPGTSPDPSANPSPNPSPWWSRSVHADRRPFLLARGRMMAAIRARLAGEGFIEVET
PALQVSPGNEAHLHAFATDLIGPDGARRTLYLRTSPEFASKKLLAAGEEQIFEFARVFRN
RERGMAHHPEFTLLEWYRAGAPYNRLMDDCAGLLACAAEAGGVSTFAWRGHTCDPFAAPE
RLTLEEAFARHAGMALATVLPAPGERPDPRPFAELAAAHGIRTAPDDTWADIFSRVLVEK
IETRLGMGRPTVLCDYPVSEAALARPKPEDPRFAERFELYACGLELANAFGELTDADEQR
RRFEEEMDEKERLYGERYPIDADFLAALAAMPPASGCALGFDRLAVLASGARRIEDVLWA
PVG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcggtatcgacgcccggcacaagccccgatcccagcgccaatcccagccccaatccc
agcccatggtggagccgctccgtccacgccgaccggcggccgttcctgctggcgcgcggg
cgcatgatggcggcgatccgcgcccgccttgccggcgaaggcttcattgaggtggagacg
ccggcgctccaggtctcgcccggcaacgaggcgcacctgcacgccttcgccaccgacctc
atcggcccggacggtgcccggcgcacgctctatctgcgcacgtcgccggaattcgcctcc
aagaagctgctggcggcgggggaagagcagatcttcgagttcgcccgtgtgttccgcaac
cgggagcgcggcatggcccaccatcccgagttcaccctgctggaatggtatcgggccggt
gcgccctataaccggctcatggacgactgtgccggccttctcgcctgtgccgccgaggcc
ggcggcgtgtcgaccttcgcctggcggggacacacctgcgaccccttcgccgcgccggag
cggctgacgctggaagaggcgttcgcgcgccacgccggcatggctctggccacggtgctg
cccgcccccggcgagcggcccgatccgaggccgtttgccgagctggcggcggcgcacggc
atccgcaccgcgccggacgacacctgggcggacatcttctcgcgggtgctggtggaaaag
atcgagacccggctcggcatggggcggcccacggtgctgtgcgactatccggtgagcgag
gcggcgctggcccggcccaagccggaggatccgcgcttcgccgagcgcttcgagctttat
gcctgcgggctggagctggccaatgcgttcggcgaactgaccgacgccgacgagcagcgc
cggcgcttcgaggaggagatggacgagaaagaacggctctatggcgagcgctatcccatc
gatgccgatttcctggccgctctggcggcgatgccgcccgcgagcggctgcgccctgggc
ttcgaccgcctcgccgttctggccagcggcgcgcgtcgcatcgaggacgtgctgtgggca
ccggtgggctga

DBGET integrated database retrieval system