KEGG   Xanthobacter autotrophicus: Xaut_2530Help
Entry
Xaut_2530         CDS       T00581                                 

Definition
(GenBank) Lysine--tRNA ligase (EC:6.1.1.6)
  KO
K04568  
elongation factor P--(R)-beta-lysine ligase [EC:6.3.1.-]
Organism
xau  Xanthobacter autotrophicus
Brite
Enzymes [BR:xau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.-  
     Xaut_2530
Translation factors [BR:xau03012]
 Prokaryotic Type
  Elongation factors
   Xaut_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2827403..2828494)
Genome map
AA seq 363 aa AA seqDB search
MAVSTPGTSPDPSANPSPNPSPWWSRSVHADRRPFLLARGRMMAAIRARLAGEGFIEVET
PALQVSPGNEAHLHAFATDLIGPDGARRTLYLRTSPEFASKKLLAAGEEQIFEFARVFRN
RERGMAHHPEFTLLEWYRAGAPYNRLMDDCAGLLACAAEAGGVSTFAWRGHTCDPFAAPE
RLTLEEAFARHAGMALATVLPAPGERPDPRPFAELAAAHGIRTAPDDTWADIFSRVLVEK
IETRLGMGRPTVLCDYPVSEAALARPKPEDPRFAERFELYACGLELANAFGELTDADEQR
RRFEEEMDEKERLYGERYPIDADFLAALAAMPPASGCALGFDRLAVLASGARRIEDVLWA
PVG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcggtatcgacgcccggcacaagccccgatcccagcgccaatcccagccccaatccc
agcccatggtggagccgctccgtccacgccgaccggcggccgttcctgctggcgcgcggg
cgcatgatggcggcgatccgcgcccgccttgccggcgaaggcttcattgaggtggagacg
ccggcgctccaggtctcgcccggcaacgaggcgcacctgcacgccttcgccaccgacctc
atcggcccggacggtgcccggcgcacgctctatctgcgcacgtcgccggaattcgcctcc
aagaagctgctggcggcgggggaagagcagatcttcgagttcgcccgtgtgttccgcaac
cgggagcgcggcatggcccaccatcccgagttcaccctgctggaatggtatcgggccggt
gcgccctataaccggctcatggacgactgtgccggccttctcgcctgtgccgccgaggcc
ggcggcgtgtcgaccttcgcctggcggggacacacctgcgaccccttcgccgcgccggag
cggctgacgctggaagaggcgttcgcgcgccacgccggcatggctctggccacggtgctg
cccgcccccggcgagcggcccgatccgaggccgtttgccgagctggcggcggcgcacggc
atccgcaccgcgccggacgacacctgggcggacatcttctcgcgggtgctggtggaaaag
atcgagacccggctcggcatggggcggcccacggtgctgtgcgactatccggtgagcgag
gcggcgctggcccggcccaagccggaggatccgcgcttcgccgagcgcttcgagctttat
gcctgcgggctggagctggccaatgcgttcggcgaactgaccgacgccgacgagcagcgc
cggcgcttcgaggaggagatggacgagaaagaacggctctatggcgagcgctatcccatc
gatgccgatttcctggccgctctggcggcgatgccgcccgcgagcggctgcgccctgggc
ttcgaccgcctcgccgttctggccagcggcgcgcgtcgcatcgaggacgtgctgtgggca
ccggtgggctga

DBGET integrated database retrieval system