KEGG   Xanthobacter autotrophicus: Xaut_2530Help
Entry
Xaut_2530         CDS       T00581                                 

Definition
lysine--tRNA ligase
Orthology
K04568  
lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
xau  Xanthobacter autotrophicus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:xau00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Xaut_2530
Enzymes [BR:xau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     Xaut_2530
Amino acid related enzymes [BR:xau01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Xaut_2530
Transfer RNA biogenesis [BR:xau03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Xaut_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2827403..2828494)
Genome map
AA seq 363 aa AA seqDB search
MAVSTPGTSPDPSANPSPNPSPWWSRSVHADRRPFLLARGRMMAAIRARLAGEGFIEVET
PALQVSPGNEAHLHAFATDLIGPDGARRTLYLRTSPEFASKKLLAAGEEQIFEFARVFRN
RERGMAHHPEFTLLEWYRAGAPYNRLMDDCAGLLACAAEAGGVSTFAWRGHTCDPFAAPE
RLTLEEAFARHAGMALATVLPAPGERPDPRPFAELAAAHGIRTAPDDTWADIFSRVLVEK
IETRLGMGRPTVLCDYPVSEAALARPKPEDPRFAERFELYACGLELANAFGELTDADEQR
RRFEEEMDEKERLYGERYPIDADFLAALAAMPPASGCALGFDRLAVLASGARRIEDVLWA
PVG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcggtatcgacgcccggcacaagccccgatcccagcgccaatcccagccccaatccc
agcccatggtggagccgctccgtccacgccgaccggcggccgttcctgctggcgcgcggg
cgcatgatggcggcgatccgcgcccgccttgccggcgaaggcttcattgaggtggagacg
ccggcgctccaggtctcgcccggcaacgaggcgcacctgcacgccttcgccaccgacctc
atcggcccggacggtgcccggcgcacgctctatctgcgcacgtcgccggaattcgcctcc
aagaagctgctggcggcgggggaagagcagatcttcgagttcgcccgtgtgttccgcaac
cgggagcgcggcatggcccaccatcccgagttcaccctgctggaatggtatcgggccggt
gcgccctataaccggctcatggacgactgtgccggccttctcgcctgtgccgccgaggcc
ggcggcgtgtcgaccttcgcctggcggggacacacctgcgaccccttcgccgcgccggag
cggctgacgctggaagaggcgttcgcgcgccacgccggcatggctctggccacggtgctg
cccgcccccggcgagcggcccgatccgaggccgtttgccgagctggcggcggcgcacggc
atccgcaccgcgccggacgacacctgggcggacatcttctcgcgggtgctggtggaaaag
atcgagacccggctcggcatggggcggcccacggtgctgtgcgactatccggtgagcgag
gcggcgctggcccggcccaagccggaggatccgcgcttcgccgagcgcttcgagctttat
gcctgcgggctggagctggccaatgcgttcggcgaactgaccgacgccgacgagcagcgc
cggcgcttcgaggaggagatggacgagaaagaacggctctatggcgagcgctatcccatc
gatgccgatttcctggccgctctggcggcgatgccgcccgcgagcggctgcgccctgggc
ttcgaccgcctcgccgttctggccagcggcgcgcgtcgcatcgaggacgtgctgtgggca
ccggtgggctga

DBGET integrated database retrieval system