KEGG   Xanthobacter autotrophicus: Xaut_2786Help
Entry
Xaut_2786         CDS       T00581                                 

Definition
(GenBank) amino acid adenylation domain
Organism
xau  Xanthobacter autotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3088812..3098438)
Genome map
AA seq 3208 aa AA seqDB search
MNRLPQPPMLLASAVPSADMATHLADLAIRQGEALALHLLDDPRDGEREVSYAALDARAR
AFAARLADHAEPGARVLLLLETGLDYVGAFFGCLYAGLIAVPAFPPEANRPQHQARLAAM
ARDCGAAIALVHAGDRAAAESLLAAQTGTAVLSVEEVADGDGDGFALRRPRPSDIAFLQY
TSGSTSTPKGVMVSHGNLIANEIAIRAGFSIQPDKTILSWLPLYHDMGLIGGLLQPLFNG
AACILMSPRHFLARPVRWLEALSRFRSEVSGGPDFAYRMCVERIDPAQVQGLDLSSWKVA
YSGSEPVRASTMEAFAARFAPLGFDARAVHPCYGLAEATLFVTAQRRGDGLKAPGFDATR
LAEGEAQPGQDPEAVRVVACGAPADDHGMRILDPATGAPVPEGRVGEVVAFGPSIAQGYW
NNPAATAATFPEIEGVRALRTGDLGFLSGGQLYLAGRAKDLIIIRGQNLYPHDIEEVIER
EVDLVRQGRIAAFPVACDDGEGIGVAVEISRRTRKTVSAQSIAALVAEVVGDAFLEPARV
VVLLEPGALPRTSSGKLQRSAVARGYQDGTLDAFAILRDGVLEDRTGEIAPMTPVAPALS
AMADKLAAIWSEVLGRQDLTADSHFFALGGNSVEAMRVRARLAALGLDVPVAELFRHPTL
GRLAAALEQIGAAKPDFVAPVTTPDGPAPLTPAQRRMWFLCEVAAGAASRSAYHVAGGIR
FEAPVDRDALAAALQDLVARHGALRTRFLRMEDGDAVQEELAAADLPLADADLGDDTDGA
HYAALAKTHAEAPFDLGAAPLARALLVRRPDGRDELLVTLHHLICDGWSLALLSEELAAA
YTARAAGSAPALPPAGSYLAYAHRQATEAPDQAGLAFWCDRLTNAPALTTLPADHPRPAE
ASHRGGRLDITFDPALTADLRALAAAADATLPMALLALFNVLLHRLSGADDLTVGLAFAN
RAAADSHVTMGLFVNTLPLRLEVDGAAAFAEVLRRVRDGVMEAQTHQHVPLDRVLDALGT
ARSLSRHPLFQTLYTHLPRRARAGVDTFTRDSGGQQFDLALETAETADGGLALAFGYALD
LFEPATVARFADAFATLARAAVAAPDTRLDLLALVDEAALAARAAPWPDDSPLPDLPVPD
LIALQARLRPDAPAVIFGEQVTSFAALEGEANRLAHVLVAHGVGPEARVGVGLPRGPGLI
AALLAVWKAGGAFVPFDPDHPAERIAHILADAGTTLVLAREGVTPGVPVLDPDQIDLSSQ
PATPVSRTAHSEQLAYLVYTSGSTGRPKGVMVAHGALAMHCRATGALYETSERTREFHFL
SMSFDGAHERWMVPLIHGGAIILTDRTPWAMADTLDTLARHRATHGGFPPAYLDALAQTA
QARGEAPPVDILSFGGEAMPAESFARAASALKPRLLINGYGPTEAVISPLAWKVPATTRL
DTPHAPIGRAVGVRRAYVLDGALNALPVGVPGELYVAGEGLARGYQAMPGATAERFLPDP
FGPPGGRMYRTGDRAHWRADGTVEYLGRTDRQIKLRGFRIEPGEVEAALRGLPGVGAAAV
ALKTVGASAQLVGYVVVAADAAPDAAALREALPSTLREALGRRLPDHMVPARLVVLQALP
LTPNGKVDYAALPVPERPAPTTESRPPQTEEEQMLARIWAEVLRLPNGPDLDANFFELGG
DSILSLQIVARARRAGLVLSARDLFEHQTIARLAGAARREETPAAPEAPHGALPLTPLQR
AFLDSGAPRLQHFNQSLVLSPTRPLDASHLAAAVDHVTRQHGALHLRFTRGADGWRQEEA
DAATTPPLAMVAAADREAAGALFASLESALDLAAGPLFRAMLANLDDGTQRLFLTAHHLV
VDAVSWRILLEEIESTYLDLEQGRPVAAPAPGTPFAVRTTHLPAATVPVPAIPLPCDHPE
GANTFGHRRVTRLALHAPQVEALRQVALAHHARLDDLLLAAVVRATGRLRGLPQLTVGIE
GHGRDLVPGADFSRTAGWFTTLAPAAVPLEDDLRRALLATKEAARRAVPDAQAPAPALIL
NHLGRVDAGRAGALFTLDAMDLSADPGQLLGAELIVDASESEAGAELRLTTSAARWEDAT
LARLSEAIAADLARLAALDSDGASPSDFPLAGLSQPALDRLALPWREIEDLYPLTPTQQG
ILFHVLEGSGDGAYVNQLSVTITGLDAERFAAAWVRAVARHAILRSAFLWTADLGAPLQA
VRRHVPFAVDRHAPMDAADTSALDAIAQDDRARGFALDAAPLMRIRLVPLGADGHHFIWT
AHHLLLDGWSSARLMAEVLADYAGAAVPPPPARFRDHVAALAAPRADGEAFWRPRLARLE
EPSLLASATRAPSVHRHLTVPLAAERWDRLGTAAKAQRVTLASLFQAAWALALKHMTGRA
AVAFGTTVSGRPDDDPRMESVLGLFIATVPTILTVPGSGRVADFVRAVQAESVATSAHAD
TPLVDILRWAGRSGQALFDSLLVFENYPMEAGLKARVVEGLAFGPVISQEATNFPLTLSV
ITDAEPRLAWSYDAAHVSSATVDQLCERLLLALDLLAGHPEADLSALSLSLPQEIAAVRA
HGIAATHVADFTPVHERIAAQARLRPDAIAVTWGADALTYADLDRHAERIARRLAEAGAG
PGDIVGISAERSPALIAGLLAILKTGAAYLPLDPIYPQARRAYMIGDAGVRCILADTANS
ADLPQTGLRHIPLDLYGEAEEDAAAMRLWPSPHPDQPAYVIYTSGSTGAPKGVVVTHGNV
ARLFTATAPWFGFGPDDVWTLFHAYGFDFSVWEIFGALSFGGRLVVVPHEVSRAPEEFLD
LVVRERVTVLNQTPSAFRPFLQVALARTETPDLALRHVIFGGEALDVGVLGPWYARFGIK
ARLVNMYGITETTVHVTYRPLGPGDVLGSSRSPIGGPIPDLTLHLLDDMLDPVPVGVPGE
LCVGGAGLAAGYLKRPGLTAARFVPDPYGPPGSRLYLSGDKAVRRPDGTLDYLGRGDGQV
KIRGFRIELGEIEARLRDDATVTDAAVVVRELPGGPALVAYVVATGTVDPTAVRERLQAG
LPDYMVPAHVVALDALPLTANGKLDRAALPEPRATATSSAPPEGADEEALAAIWRDVLGA
GAIGREDNFFALGGHSLSATQVRLEIRDRLGVEVPVRRLFECQTLRSLAQVLAETRATET
RATGAAPRPALGADALAQMDALLGELEG
NT seq 9627 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgcctgccgcagccacccatgctcctcgcctccgccgtcccgtccgccgacatg
gcgacccaccttgccgacttggcaatccgccagggcgaggcgctggcgctgcacctgctg
gatgacccgcgcgacggcgaacgcgaggtgagctacgccgccctcgacgcgcgggcgcgg
gccttcgccgcgcggctggctgaccatgcggagccgggcgcgcgggtgctgctgctgctc
gaaaccggccttgactatgtgggcgccttcttcggttgtctttatgccgggctgatcgcc
gttcccgccttcccgcccgaggccaaccggccccagcaccaggcccgccttgccgccatg
gcgcgcgattgcggcgccgccatcgcactcgtccatgccggcgaccgcgcggcggcggag
agccttctcgccgcccagacgggcacggcggtgctgagcgtggaggaggtggcggatggc
gacggagacggcttcgctctgcgacggccccgcccgtccgatattgccttcctgcaatac
acttccggctccacctccacccccaagggcgtgatggtgagccacggcaacctcatcgcc
aacgaaatcgccatccgcgccggcttctcgatccagccggacaagaccatcctgagctgg
ctgccgctctatcacgacatgggcctgatcggcgggctgctgcagccgctgttcaatggc
gccgcctgcattctcatgtcgccgcgccatttcctcgcccggccggtgcgttggctggag
gccctgtcgcgcttccgctcggaggtcagcggcgggccggacttcgcctatcgcatgtgc
gtcgagcgcatcgatccggcgcaggtgcaggggctcgatctctcgtcctggaaggtcgcc
tattccggctccgagccggtgcgcgcctccaccatggaagccttcgccgctcgcttcgct
ccgctgggctttgacgcccgggcggtgcatccctgctacggccttgccgaggcgaccttg
ttcgtcaccgcccagcggcggggcgacggcctgaaggcccccgggttcgacgccacgcgg
ctggccgagggcgaagcgcagcctggccaagaccctgaagcggtgcgcgtggtcgcctgc
ggcgcgccggcggacgaccacggcatgcgcatcctcgatcccgccaccggcgcgccggtg
cccgagggccgggtgggcgaggtggtggccttcggccccagcatcgcccaaggctactgg
aacaaccccgccgccaccgccgccaccttccccgaaatcgaaggcgttcgggcgctgcgc
accggcgacctcggcttcctctccggcggacagctttatctggcgggccgagccaaggac
ctcatcatcatccgcggccagaacctttacccccacgacatcgaggaggtgatcgagcgg
gaggtggatctggtgcggcagggccgcatcgccgcattcccggtggcctgcgacgatggc
gagggcatcggcgtcgccgtggaaatctcccgccgcacccgcaagaccgtgtcggcgcaa
agcattgcggcgctggtggccgaggtggtgggcgacgccttcctcgaaccggcgcgggtg
gtggtgctgctggagcccggcgcgctgccgcgcacctccagcggcaagctgcagcgcagc
gccgtggcgcggggctatcaggatggcaccctcgacgccttcgccatcctgcgcgacggc
gtgctggaggaccggaccggcgaaatcgctcccatgacgccggtcgcgcccgccctcagc
gccatggcggacaagcttgccgccatctggtcggaggtgctgggtcggcaggacctcaca
gccgacagccatttctttgccctcggcggcaattcggtggaggccatgcgggtgcgcgcg
cgcctcgccgcgctcgggctggatgtgcccgtggcggagctgttccgccatcccaccctc
ggccgcctcgccgccgctttggagcagatcggggcggctaagcccgatttcgttgcaccc
gttaccaccccggatggcccggcgccgctgacccccgcgcagcgacgcatgtggttcctc
tgcgaggtcgccgctggtgcggcgagccggtccgcctatcacgtggccggcggcatccgc
tttgaggcgccggtcgaccgtgacgcactcgccgccgcgcttcaggacctggtggcccgc
cacggggcgctgcgcacacgcttcctgcgcatggaggacggcgatgcggtgcaggaggaa
ttggccgccgccgatttgcccctcgccgacgccgaccttggcgacgacacggacggcgcc
cattatgccgccctcgccaagacccatgcggaagcaccgttcgacctcggcgccgcgccc
cttgcccgcgccctgctggtgcgtcgtccggacgggcgggacgaactgctcgtcacgctc
caccacctgatctgcgacggctggtccctcgcccttctcagcgaggaactcgccgccgcc
tacaccgcgcgcgccgccggatccgcacccgcgctgccgccggcgggatcctacctcgcc
tatgcccaccggcaggctacggaggccccggaccaagccggccttgccttctggtgcgac
cgcctcaccaatgcccccgccctcaccaccctgcccgccgaccacccccggccggccgag
gcgagccatcgcggcgggcggctcgacatcaccttcgacccggccctgacggccgacctg
cgcgcgctcgcggcagccgccgacgccacactgcccatggcgctccttgccctgttcaac
gtgctgctgcatcgcctttcgggcgccgacgacctcaccgtgggcctcgccttcgccaac
cgcgcggccgccgacagccacgtcaccatgggcctgttcgtgaataccctgccgctccgc
cttgaggtggacggcgctgcggcattcgccgaggtgttgcgccgtgtccgcgacggggtg
atggaggcgcaaacgcaccagcacgtgccgctggatcgggtgctcgacgccctcggcacc
gcgcgcagcctcagccgccatccattgttccagaccctctacacccacctgccgcgccgg
gcccgggcaggagtggacaccttcacccgagacagcggcggccagcagttcgacctggcg
ctggagactgccgagaccgcagatggcggcctcgcgctggccttcggctatgcgctggac
ctgttcgagccggccaccgtggcccgcttcgccgacgccttcgccaccctcgcccgagcc
gcggtcgcggcgcccgatacccggctcgacctcctcgcgctggtggacgaggcggcactc
gccgcccgcgccgccccctggccggacgacagccccctgcccgacctgccggtgccggac
ctcatcgccctgcaggcgcggcttcggcccgacgctccggcggtgattttcggcgaacag
gtcacatccttcgccgcgctggagggtgaggccaaccgcctcgctcatgtgctcgtcgcc
catggggtggggccggaggcgcgggtgggcgtgggcctgccgcgcgggccgggcctcatc
gccgccctgctcgcggtgtggaaggccggcggcgccttcgtgccgttcgatcccgaccat
ccggccgagcgcatcgcccacatcctcgccgatgccggcaccacgctggtgctggcgcgg
gagggcgtcacgccaggggtgcccgttctcgacccggaccagatcgacctgtcgtcccag
ccggcgaccccggtgagccggacggcgcattccgagcagctcgcctacctggtctacacc
tccggctccaccggccgccccaagggggtgatggtggcccacggcgcgctcgccatgcac
tgccgcgccaccggcgcgctctacgagacctccgagcgcacgcgggaattccactttctc
tccatgagcttcgatggcgcgcacgagcgctggatggtgccgctcatccacggcggcgcc
atcatcctcaccgaccgtaccccctgggccatggccgacacgctggacaccctcgcccgc
caccgcgccacccacggcggcttccctccggcctatctcgacgcgctggcgcagaccgca
caggcgcgcggcgaagcccctcccgtggacatcctgtccttcggcggcgaggccatgccg
gcggagagcttcgcgcgcgccgccagcgcgctgaagccccgcctgctcatcaacggctac
ggccccaccgaagcggtgatctcgcccctcgcctggaaggtgccggcgacaacccgcctc
gacaccccccacgcccccattggccgcgccgtgggcgtgcggcgggcctatgtgctggat
ggcgccctcaatgccttgcctgtgggcgtgcccggcgagctttacgtggccggggaaggc
ctggcgcgtggataccaggccatgcccggcgccaccgccgagcgcttcctgcccgatccc
ttcgggccgccgggcgggcgcatgtatcgcaccggcgaccgcgcccactggcgcgccgac
ggcacggtggagtatctcggccgcaccgaccggcagatcaagctgcgcggcttccgcatc
gagcccggcgaggtggaggccgcgctgcgggggctgcccggagtgggtgccgccgcagtt
gccctgaagaccgtgggcgcttcggcccagctcgtgggttatgtcgtggtggcggcggat
gcagctcccgatgccgcagcgctgcgcgaggccttgccctccacgttgcgcgaggccttg
ggccgtcgcctgcccgatcacatggtgcccgcccgcctcgtggtgcttcaggccttgcca
ctgacccccaacggcaaggtggactacgccgccctgcccgttcccgagcgccccgccccg
acgaccgagagccgcccgccgcagacggaagaagaacagatgctcgcccgcatctgggcg
gaagtgctgcgcctgccgaacggtcccgacctcgacgccaatttcttcgagctgggcggg
gattccatcctgagcctgcagatcgtcgcccgcgcccgccgcgccgggctggtactgtcc
gcgcgcgacctgttcgagcaccagaccatcgcccgcctcgccggtgccgcccggcgggag
gagacgccggcggcacccgaagccccgcatggcgccctgcccctcaccccgctccagcgc
gccttcctcgacagcggcgcgccgcgcctccagcacttcaatcagtcgctggttctctcc
cccacccggccgctggatgccagccatctcgcggccgccgtcgaccatgtgacccgccag
cacggcgccctccacctgcgcttcacacggggagcggacggctggcggcaggaggaggct
gatgccgccacgacaccgcccctcgctatggtcgcggcggcggaccgggaggccgcaggc
gccctcttcgcctccctcgaaagcgcgctcgacctcgccgcaggcccgctcttccgtgcg
atgctggcaaacctcgacgatggcacgcaacgactgttcctgaccgcccatcacctggtg
gtggacgcggtgtcctggcgcatcctgctggaggagatcgagagcacctatctcgacctg
gaacagggccgccccgtcgccgcgccggcccccggcacgcccttcgccgtccgcacgacg
cacctgccggcggcgacagtcccggtacccgccatccccctgccctgcgaccatcctgag
ggcgcgaacacgttcggccaccgccgcgtgacccgcctcgccctccatgccccgcaggtg
gaagcgctgcgtcaggtggcgctcgcccaccatgcccggctcgatgacctcttgctcgcc
gctgtggtgcgggccacaggacgcctgcgcggcctgccccagcttactgtgggcatcgaa
gggcacgggcgggacctggttccgggcgccgatttcagccgcacggcgggctggttcacc
accctcgcgccggcggcggtgccgctggaggacgacctgcgccgcgcccttctcgccacc
aaggaggccgcccgccgggcggtcccagacgcacaagccccggccccggcactcattttg
aaccatctcggacgggtggatgcgggccgcgccggcgccctgttcaccctcgacgccatg
gacctctcggccgatccgggccagctcctcggcgccgagctgatcgtggatgccagcgag
agcgaggctggcgccgaactgcgcctcaccacctctgccgcgcgatgggaggatgcgacc
ctcgcccgcctcagcgaggccatcgccgccgaccttgcccgccttgcagcgctcgacagc
gacggcgcctcgccctccgacttcccccttgccggcctttcccagccggcgctggaccgt
ctcgccctgccctggcgcgagatcgaggacctctacccgttgacgccgacccagcagggc
atcctcttccatgtgctggaggggtccggggatggcgcatatgtgaaccagctcagcgtc
accatcaccgggctggacgcggagcgcttcgccgccgcctgggtgcgggcggtggcgcgc
cacgccatcctgcgcagtgccttcctgtggaccgccgacctcggcgcgcccttgcaggcg
gtgcggcggcatgtgcctttcgccgtggaccggcacgcacccatggacgcagcggacacg
tccgccctcgacgccatcgcgcaggacgaccgcgcgcgcggcttcgcgctggatgcggcg
ccgctcatgcgcatccgcctcgtgccgctcggggccgacgggcatcatttcatctggacc
gcccatcacctgctgctggacggctggagttccgcccgcctcatggcggaagtgctggcc
gactatgcgggcgccgccgtgcccccgcccccggcacggttccgcgatcatgtggcggcc
ctcgccgccccgcgcgccgatggcgaggccttctggcgtccgcggctggcccggctcgaa
gagccatccctgcttgccagcgcaaccagagctccttccgttcaccggcacctcaccgtg
ccactggcggcggagcgctgggatcgcctaggcacggccgcgaaggcgcagcgggtgacc
ctcgccagcctgttccaggcggcctgggcgctggcgctgaagcacatgaccgggcgggcc
gccgtggcattcggcactacggtctccggccggccggacgacgacccgcgcatggagagc
gtgctcggcctgttcatcgccaccgtgccgacgatcctcaccgtgccagggtccgggcgg
gtggcggatttcgtgcgcgcggttcaggcggaaagcgtggcgaccagcgcccatgcggac
acgccgctggtggacatcctgcgctgggccggacgcagtgggcaggcgctgttcgacagc
ctgctggtgttcgaaaactatcccatggaagccggcctgaaggcgcgcgtggtggaggga
ctcgccttcggcccggtgatctcgcaggaggccaccaacttccccctcaccctcagcgtc
atcaccgacgccgagcctcgcctcgcctggagctacgacgccgcgcacgtttcgagcgcg
actgtggaccagctctgcgagcgccttctgttggccctcgacctcctggccgggcatccg
gaggcggacctctccgccctctccctcagcctgccgcaggagatcgccgccgttcgtgca
cacggcatcgccgccacacacgtcgcggacttcacgccggtgcatgagcgcatcgccgcg
caggcccgcctgcggccggacgccatcgccgtcacctggggcgcggacgccttgacctac
gccgatctcgaccgccatgcggagcgcatcgcccgccgtcttgcggaggcgggcgcgggg
ccgggcgacatcgtgggcatcagcgccgagcgctctccggcgctgatcgccgggctcctc
gccatcctgaagaccggtgccgcctacctgcccctcgatccgatctacccacaggcgcgc
cgcgcctacatgatcggtgatgccggggtgcgctgcatcctcgccgacaccgccaattct
gccgatctgccgcagaccgggctgcgacacatccccctcgacctttatggggaggccgag
gaggatgcggcggcgatgcgcctttggccatcgccgcacccggaccaacccgcctatgtc
atctacacgtccggctccaccggcgcgccgaagggcgtggtggtgacccatggcaacgtg
gcgcgccttttcaccgccaccgcgccgtggttcggcttcggaccggacgatgtgtggacc
ctgttccacgcctatggcttcgacttctcggtgtgggaaatcttcggcgccctcagcttt
ggcgggcggctggtggtggtgccccacgaggtgagccgcgcgccggaggagttcctggac
ctcgtggtgcgcgagcgcgtcaccgtgctgaaccagaccccctccgccttccgccccttc
ctgcaggtggcgctggcccggaccgagacgccggaccttgccctgcgccacgtcatcttc
ggcggcgaggcgctggacgtgggcgtgctcggcccctggtacgcgcgcttcggcatcaag
gcccgcctggtcaacatgtacggcatcaccgagaccacggtgcatgtcacctaccgcccg
ctcggccccggcgacgttctaggctcaagccgcagccccatcggcggtcccatccccgac
ctcacgctgcatctcctcgatgacatgctggacccggtgccggtcggcgttccgggcgag
ctgtgcgtcggcggcgcgggccttgccgcaggctacctgaagcggccgggccttaccgct
gcgcgcttcgtgccggacccctatgggccgcccggcagccggctctatctcagcggcgac
aaggcggtgcgacggccggacggaaccctcgactatctcggtcgcggcgacgggcaggtg
aagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgcctgcgcgacgatgcc
actgttaccgacgccgccgtggtggtgcgggagcttcccggcggaccggccctggtggcc
tatgtggtggcgaccggcacggtcgatccgaccgccgtccgcgagcggcttcaggcggga
ttgccggactatatggtgccggcccatgtggtcgccctcgacgcgctgcccctcaccgcc
aacggcaagctggaccgcgccgccttgcccgagccgcgtgccaccgccacgtcctccgcg
ccgccggaaggagccgacgaggaagccctcgccgccatctggcgcgacgtgctgggcgca
ggcgcaatcggccgcgaggacaatttcttcgccctcggcggccattccctgtcggcaacg
caggtccggctcgaaatccgcgaccggctcggcgtggaggttccggtgcgccggctgttc
gaatgccagaccctgcgcagccttgcccaggtgctggccgaaacccgcgccacggagacg
cgcgccaccggggccgcgcccaggccggcgctcggcgcagatgcgctggcgcagatggat
gcgctgctcggcgaactggagggatga

DBGET integrated database retrieval system