KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1192Help
Entry
XACM_1192         CDS       T01616                                 

Definition
(GenBank) dipeptidyl carboxypeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Brite
Enzymes [BR:xax01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XACM_1192
Peptidases [BR:xax01002]
 Metallo Peptidases
  Family M2
   XACM_1192
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XACM_1192
CD molecules [BR:xax04090]
 Proteins
  XACM_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1336692..1338710)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSACRRDAAPPDTPVASKTAPAESADQFVARISAEYKAAYPE
ITAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADAGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLSAVLARNTGGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEPNQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSEWLKQQNQGQMCGWQATAAA
PATTTTAPATAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcgttggccgtggctgccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacacacctgtcgcgagcaagaccgcgccggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
atcactgcggcgcagtggctgtcgtcgacctacatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagttggaccggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcaattgctgaaattgatg
agtgccctgcccgcaccgcgcgacccggccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgcgggcagctactgcgtgggcgaaggcgagcagcgccgc
tgccgccagctcggcgagttggagcaagtgttggccagcagccgcgactacaacgaacaa
ctcgacgcctggcagggctggcacagcactgcgcagcccatgcgcaaggactaccaacgc
ttcgtcgaactggccaacgagggcgcacgcgggctgggtttcgccgacgccggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgtctgtgg
gaacaggtcaaacccttgtatgcgcagttgcagtgctatgcgcgcggcaaactcgatacg
caatacggcaaggacaagggcgaggtcgccggcggcctgttgccggcacacctgatgggc
aatatgtggcagcaggactggagcaacctgtgggatctgctgcagccctaccctggcgcc
ggcgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcagcgcagtg
ctggcgcgcaataccggcggcgatggtggcgcggccgcacgcttcaacgccgaacgcgag
gcgcagctgcgtaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacgtattggcagcgctcgcagttcatcaagccgctggat
cgcgatgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgagccgaaccag
aacatcggcgcggacgtgcgcaccaagatgtgcatcaagccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcttataacccgttgccgccg
ctgttccagaacggcgccaacgatggcttccacgaagcaatcggcgacaccatcgtgctg
gcgatgacgcccaagtacctgcagtcgatcggcatggtgggcgagcaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggccctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactgaaagccaagtaccagggcgtggcgccggtcagcgcg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacacgccgtac
acgcgctatttcctggcgcatatcctgcaattccaattctacaaaggcctgtgccaggcc
gccggccatcaggggccgctgtacgaatgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcagcgtggttccagccaaccctggcagaccacactcaaggaa
ctcaccggcaacgacaaactcgatgccggaccgatgctggaatacttcgcgccgatgagc
gaatggctcaagcagcagaatcaagggcagatgtgcgggtggcaggcaacggccgccgct
ccggcaaccacgacgactgcgcctgcgacggcgcgctga

DBGET integrated database retrieval system