KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2420Help
Entry
XACM_2420         CDS       T01616                                 

Gene name
lig3
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xax00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    XACM_2420 (lig3)
Enzymes [BR:xax01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XACM_2420 (lig3)
DNA repair and recombination proteins [BR:xax03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     XACM_2420 (lig3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2752383..2755001)
Genome map
AA seq 872 aa AA seqDB search
MSLSEYRRKRSFNKTREPEPGKALPPGQRAIFVVQLHHASRRHYDFRLQVGDALKSWAVP
KGPSYDPKVKRMAVEVEDHPVDYASFEGEIPKGEYGGGHVAQFDHGVWATAGDPEAQLAK
GHLRFELFGNKLKGGWHLVRSGKPARQPQWLLFKDDDAYAGTLEADDLLADVAAAPAEDV
RRAGAGKTQRKALTTVPPPAAKRRGTWAKQALALSNARRAEMEDAPFAPQLAKLGQSPPE
GAQWLHEIKWDGYRILATVTNGKVRLWSRNALEWTDKTPEIADAIRSLGLRSAQIDGELI
AGRGTKDDFNLLQATLSGERQVPLALAVFDLLHVDGVDISEAPLRERKRLLQQVLEAAPH
THLAYSSHVEGDGTEAFRVAGQQHFEGIISKRADRPYRDGRSDDWRKTKQLASQEYAVVG
YTAPKGSRSGFGSLLLATPDPVHGWLYVGRVGSGFSDALMREVTPQLEGGGRKPTAHIPT
EDTDLRGATWFAPRFVVEVFYRGIGGQQLLRQASFKALRPDKRIADLADSDAGNGPATPS
SARRSATTRAAKDTATQAPKRAATRATAPARKSAVATPSSAALPTLSSPTKLIYPDIRAT
KGDVWDYYQAVMDHLLPQIVGRPLSIIRCPSGAEKPCFFQKHHTAGLERVSSVKLTEETG
TNAYYLVVEDAPGLLELVQFNALEFHPWGSHADRPDVADRVVFDLDPGPDVPFAEVKRAA
TDIRKLLAQLELESFLRVSGGKGLHVVVPLNPGCDWEVTKRFAKGFADALAQAQPQRFIA
TATKRLRNKRIFVDYLRNGRGATAVASYSLRGRPGAPVALPLAWSDLSKLQRADAFTLRD
VPEKLRRRRKDPWADMDGIRQNLARWAEQDQD
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgagcgaatatcgccgcaagcgcagctttaacaagacccgcgagccggagccg
ggcaaggccctgccgccggggcagcgtgcgatcttcgtggtgcaactgcaccacgccagc
cgccgccattacgactttcgcctgcaggtgggcgatgcgctcaagagctgggcggtgccg
aagggtcccagttacgaccccaaggtcaagcgcatggcagtggaggtggaagaccacccg
gtcgattacgccagtttcgagggcgagattcccaaaggcgaatacggcggcgggcatgtg
gcgcagttcgatcatggcgtgtgggccaccgcgggcgaccccgaagcgcaattagccaag
ggacatctgcgctttgagttgttcggcaacaagctcaagggcggttggcatctggtgcgc
tcgggcaagccggcgcggcagccgcagtggctgttgttcaaggacgacgatgcctacgcc
ggcacgttggaggccgatgacctgctggccgacgtcgctgccgcgcctgccgaggatgta
cgccgcgcaggcgccggcaagacccagcgcaaggcgctgacgaccgtgccgccgccggcg
gcgaagaggcgtggtacctgggcgaaacaggcgctggcgctgagcaatgcacgtcgcgcc
gagatggaagatgccccgtttgcaccgcagctggccaagctggggcagtccccgccagaa
ggggcgcagtggctgcatgaaatcaaatgggacggttatcgcatcctggccaccgtgacc
aacggcaaggtgaggctatggtcgcgcaatgcattggagtggaccgacaagacgccggaa
attgccgatgccatccggtcgctgggcctgcgcagcgcgcagatcgatggcgaactgatc
gccggacgcggcaccaaggacgacttcaacctgctgcaggccaccttgtccggcgagcgc
caggtgccgctggcgctggcggtattcgacctgttgcatgtggacggggtggacatcagc
gaggcgccgctgcgcgaacgcaagcggctgttgcagcaggtgctggaggctgcacctcac
acgcatctggcctatagctcgcacgtcgaaggcgatggcaccgaggcgttccgggtggcc
gggcaacagcacttcgaaggcatcatttccaagcgcgcagatcgcccgtatcgcgatggg
cgtagcgacgattggcgcaagaccaagcaactggccagccaggagtatgcggtggtcggc
tacaccgcgcccaagggcagccgcagtggcttcggctcgctgttgctggccacgccggac
ccggtgcatggctggttgtacgtgggccgtgtgggctccgggttctccgatgccttgatg
cgcgaggtcaccccgcaactggaaggtggcgggcgcaaacccaccgcgcatattcccacc
gaagacaccgacctgcgcggcgccacctggtttgcgccgcgctttgtggtggaggtgttc
tatcgcggcattggtgggcaacagttgttgcgccaggcctcgttcaaggcgctgcgtccg
gataagcgcattgccgatctggccgacagcgatgccggaaatggcccggctacaccgtcc
tctgccaggcgttcggcaacaacgcgtgctgccaaagacacagcaacgcaggcgcccaaa
cgcgcagcgacgcgggcaacagcacctgcgcgcaaatctgcggttgccacaccttcctcg
gctgcgctgccgacgctgtccagcccgaccaagctgatctacccggatatccgcgcgacc
aagggcgatgtctgggactattaccaggcggtgatggatcacctattgccgcagatcgtg
ggacggccgctgtccatcatccgctgccccagcggcgcggaaaaaccgtgttttttccag
aagcaccatactgccggccttgagcgtgtgagctcggtcaagctgaccgaagagaccgga
accaacgcgtattacctggtggtcgaagacgcgcctggcctgctggaactggtgcaattc
aatgcgctggaattccacccctggggctcgcatgcggaccgcccggatgtggccgaccgg
gtggtcttcgatctcgatccgggcccggacgtgccgtttgccgaggtcaaacgtgcggcc
accgatattcgcaagcttttggcgcagctggagctggaatcgttcttgcgtgtgtctggc
ggcaaggggctgcacgtggtggtgcccctgaaccccggctgcgattgggaggtgaccaag
cgtttcgccaagggatttgccgatgccctggcgcaggcgcagccgcagcggttcatcgcc
actgccaccaagcggctgcgcaacaagcgcatcttcgtggactacctgcgcaacgggcgt
ggcgccactgcggttgcgtcctattcgttacgcggccgcccgggggcgccagtcgcgttg
ccgctggcgtggtcggacctgtccaagctgcagcgcgccgatgcattcaccttgcgcgat
gtcccggagaagctgcgccgtcggcgcaaggacccctgggcagacatggacggcatccgg
caaaacctggcgcgctgggcagaacaggaccaggactga

DBGET integrated database retrieval system