KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4123Help
Entry
XACM_4123         CDS       T01616                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XACM_4123
  Lipid metabolism
   00600 Sphingolipid metabolism
    XACM_4123
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XACM_4123
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XACM_4123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4793631..4796402)
Genome map
AA seq 923 aa AA seqDB search
MRAHAKHNVTRALRAGYAVRACTGLFWLCSAWPIIAAPHAASDASRERISLDAQWRFHRG
DPPANQEILDYDVRPQVVRSSDGRVADAQPEQAQLIDAPAVRVLKPWILPTANGLIADPA
QRHIRPPGNPGSTVAYVQPHFDDSAWETVDLPHDWAIAGPFLADGPYGGMGRLPSWGIGW
YRKRLDIPASDRGRAMFLELDGAMSYATVWLNGKLVGGWPYGYSSWRVDLTPYVIAGKRN
QLVIRLDNPPESARWYPGGGLYRNVWLTKAAPLHIAHWGTQLTTPYVSADAAQVQLTVTL
DNAARGATQAQVRTAIYLLDDASDRPSGEAVARIPAQPISVPAGGTAQVQGSTRIDAPRL
WGPPPTQHPHRYVAVTEVDQQGRVVDRYETRFGIRSIVFDADKGLLVNGEHVPIRGVNNH
HDLGALGAAFNRRAAERQLQLLQQMGANAIRMSHNPPAPELLDLTDRMGLLVVDEVFDSW
EMKKTPLDFHLVFPQWHAADLRAMLRRDRNHPSVMLWSVGNEVGEQYTGQQGAAIARTLR
AIVHAEDPTRPATVAMNYASPEMPLPAALDVVSLNYQGEGIRDAAEFEGTERIRKPPQYP
AFHARFPHKAIVSSETASALSSRGVYLFPVTADNSAPVRDGRGGDSVAHQVSAYELHAVD
FGSSADKVFAALDQHPYVAGEFVWTGFDYLGEPTPYYSSRSSYSGIFDLAGFPKDRYWLY
QSRWRPELPVAHLLPHWSWPGREGQVTPVHVFTSGDEAELFVNGVSQGRKRKAPRQYRLR
WDAVVYQPGELRVQAYKDGKPWASERVQTAGRAARMQLMPDRGSIRGDGQDLSFITVRLL
DRDGRPAPTAGDRLRFRIEGPGELVATDNGDPTNLETFAASQRHAFNGLCLAIVRAKAGA
HGTITVHVESDTLQAAQTQVAVQ
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacacgccaagcacaacgtcacacgagcgctgcgcgcaggttatgcagtacgt
gcctgcacggggcttttctggctctgcagtgcatggcccatcatcgcagcaccgcacgct
gccagcgacgcctcgcgcgaacgtatttcgctggatgcgcagtggcgctttcatcgtggc
gacccgcccgcaaaccaggaaatcctggactacgatgtgcgcccgcaagtggtgcgcagc
agcgatggcagggtggccgatgcgcagccggaacaagcgcagctcatcgatgcgcccgcc
gtgcgcgtgctcaagccgtggatcctgcccaccgccaacggtttgatcgcagacccggcc
caacggcacatacgccctccaggcaatccgggcagcacggtggcgtatgtgcagccgcac
ttcgacgacagcgcatgggaaaccgtggacctgccgcatgactgggccattgccgggccg
ttcctggcagatgggccttacggtggcatgggtcggttgccgagctggggcatcggctgg
tatcgcaagcgcctggacatcccggccagcgatcgcggccgcgcgatgtttctggagctc
gatggtgcgatgtcttacgccacggtctggctcaacggcaaacttgtcggcggctggccg
tacggttacagctcctggcgcgtggatctgacgccgtatgtgatcgcaggcaagcgcaat
cagctggtcattcgcctggataacccgcccgagtcggcgcgttggtatccgggcggcggg
ctgtatcgcaacgtgtggctgaccaaagcggcgccgttgcatatcgcgcactggggcacg
cagctgaccacgccgtacgtctcggccgatgcggcgcaggtgcagctgaccgtcaccttg
gacaacgccgcccgcggcgcaacccaggcgcaggtgcgcacagcgatttatctgctcgac
gatgcaagcgaccggcccagtggcgaagcggtcgcgcgcattcccgcgcagcccatcagc
gtccctgccggcggcacggcgcaggtgcaaggcagcacccggatcgatgccccgcgcctg
tgggggcctccacccacgcagcacccgcatcgctatgtggccgtcaccgaggtcgaccaa
cagggacgcgtggtggaccgctacgaaacccgcttcggcattcgcagcatcgtgttcgac
gccgacaagggcctactggtcaacggcgagcacgtgccgatccgcggggtgaacaatcat
cacgacctgggcgcgctcggtgcagcgttcaacaggcgcgccgccgagcgacagttgcaa
ttgctgcagcagatgggcgccaacgccatccgcatgagccataacccgcctgcgcccgaa
ttgctcgacctgaccgaccgcatgggtctgctggtggtggatgaggtgttcgacagttgg
gagatgaagaagaccccgctggactttcatctggtgtttccgcagtggcatgccgccgat
ctgcgcgcgatgctgcgccgcgaccgcaaccacccctcggtgatgctgtggagcgtgggc
aacgaggttggcgagcaatacaccggccaacagggcgcggcgattgcgcgcacgctgcgc
gccatcgtgcatgcagaagacccgacgcgcccggccacggtggcgatgaactacgcctcg
cccgagatgccgctgcccgctgcgctggatgtcgtcagcctcaattaccagggcgaaggc
atccgcgatgcagccgagttcgagggtaccgagcgcatccgtaaaccgccgcaatacccc
gcgttccatgcacggtttccacacaaggccattgtcagcagcgagactgcctcggcactg
agcagtcgtggcgtgtacctgtttccggtcactgcggacaacagcgcaccggtacgcgat
ggccgtggcggcgattcggtggcgcatcaggtcagcgcgtacgaactgcatgcggtggac
tttggctccagcgcggacaaggtgttcgctgcgttggatcaacacccttacgtggccggt
gagttcgtctggaccgggttcgattacctgggcgagcccaccccgtattacagctcgcgc
agttcctactcgggcatcttcgatctggccggcttcccgaaggaccgttactggctctat
cagtcgcgctggcgtccggaactgccggtggcgcatctgctgccgcattggagctggcca
gggcgcgaaggacaggtcacgcccgtgcatgtgttcacctccggcgacgaggccgaactc
ttcgtcaacggcgtttcgcaggggcgcaagcgcaaggcgccacggcagtaccggctacgc
tgggacgcggtggtgtaccagccgggcgaattgcgggtgcaggcgtacaaggacggcaag
ccgtgggccagcgagcgcgtgcagacggcaggccgcgccgcgcgcatgcagctgatgccg
gatcggggcagtatccgcggcgacggacaggacctgagcttcatcaccgtgcgcctgctc
gatcgcgacggacgtcccgcaccgaccgcgggcgaccgcctgcgcttccgcatcgaaggc
cctggcgagttggtggccaccgacaacggcgaccccaccaatctggaaacgttcgctgcg
tcgcaacgtcatgccttcaacgggctgtgcctggcgatcgtgcgtgccaaggccggggcg
catggcacgatcaccgtgcatgtggaatcggacacgttgcaagccgcacagacccaggtg
gcggtgcagtga

DBGET integrated database retrieval system