KEGG   Xenorhabdus bovienii CS03: XBW1_2245Help
Entry
XBW1_2245         CDS       T03845                                 

Gene name
yeaD
Definition
(GenBank) putative glucose-6-phosphate 1-epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xbv  Xenorhabdus bovienii CS03
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xbv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBW1_2245 (yeaD)
Enzymes [BR:xbv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XBW1_2245 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2149880..2150752
Genome map
AA seq 290 aa AA seqDB search
MLDKIFSLPVVEQISPYISQRNIEGFPLIVVSHPKVRGAISIQGAHLITWQPSGEKPVLW
LSDNTEFNTGTAIRGGIPICWPWFGSTSAPSHGFARILPWEFRAHHENENGVILTFTLQD
NADTHKLWSHEFTLIARFKLGETCEIELESHGEYQATCALHSYFNISDVNQIRVSGLGAH
FIDTVADKKQYVHEDLTFKGRIDRIYTEPEDFSLLSDTSWKRTIEIHHYHHSDVVCWNPG
AELSSSMKDMSKEGYKNMVCIETARINSPQLSRNNNPARLSVVIRCRKNP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaattttctcattaccggttgtagaacaaatatctccttatatcagtcag
cgaaatattgaaggatttccgctgattgttgtttcacaccctaaagtgcgcggcgcaatc
agtattcagggtgcacatcttattacatggcagcccagtggcgaaaaacctgtattatgg
ttaagcgataacactgaatttaatacaggtacagccattcgtggtggcattcccatttgc
tggccttggtttggctcgacaagcgctcccagtcacggttttgcacggatcttaccttgg
gaattcagggcacaccatgaaaatgaaaacggcgtgatcttgacatttacgctacaagat
aacgccgatacacataagttatggtcacacgagttcacactcattgcccgttttaagtta
ggggaaacctgcgaaatagagctggagtctcacggagaatatcaagcaacatgtgcgctc
cactcttacttcaatatcagtgatgtcaatcaaatccgtgtcagcgggcttggtgctcat
tttatcgataccgttgccgataaaaaacagtacgttcacgaagatctgacttttaaagga
cgaattgaccgtatttatactgaaccagaagatttcagcctactcagtgatacatcgtgg
aaacgaactattgaaattcaccattatcaccatagtgatgtagtttgctggaatcccggt
gccgaactttccagcagtatgaaagatatgagtaaagaaggttataagaatatggtttgc
atcgaaactgcacgtatcaattccccacagctatccagaaataacaaccctgccagactt
tctgtggttatccgttgccgcaaaaatccttga

DBGET integrated database retrieval system