KEGG   Xanthomonas campestris pv. campestris 8004: XC_3130Help
Entry
XC_3130           CDS       T00247                                 

Definition
(GenBank) dipeptidyl carboxypeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XC_3130
Peptidases [BR:xcb01002]
 Metallo Peptidases
  Family M2
   XC_3130
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XC_3130
CD molecules [BR:xcb04090]
 Proteins
  XC_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3738587..3740605
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSSCRQDAVPTPKPATTKTAPSESADQFVARISAEYKAAYPE
MTAAQWLSSTYINGDSQLLAAKANERALSQLDRWIDQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPTKLAELTRIAAKMEGDYGAGSACTGEGEQRRCRQLGELEQVLARSRDYDEQ
LQAWQGWHATAQPMRKDYQRFVELANDGARGMGFADVGAMWRSGYDMPPAQLASETDRLW
EQLKPLYTQLQCYARGKLDTQYGKDKGEVAGGMLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLSAVLARNTGGDGGAAARFLAERDAQLRTAQQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEPNAGIGPDVRTKMCIRPTEEDFT
TIYHELGHIYYDMAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQSGR
EALINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSIPPERYNQAWWELKATYQGVAPVSP
RGEDFFDAGAKYHVPGNTPYTRYFLAHILQFQFYKGLCDAAGHQGPLYECSFYGNKEAGQ
KFWSMLQRGSSQPWQTTLKEVTGKDTLDAGPMLEYFAPMQEWLKQQNQGQMCGWQAKGAT
ATPPATPAPSAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtctgctgttgctggcgctcgccgttgccgccggtacgttgtcgctgtcg
tcgtgccgccaggatgcggtgccgacgcccaagcccgccaccaccaaaaccgcacccagc
gaaagcgccgaccagttcgtggcgcgcatcagtgccgaatacaaggcggcgtatccggaa
atgactgccgcgcagtggctgtcgtcgacctacatcaacggcgactcgcagttgctggcg
gccaaggccaacgagcgcgcgctgagccagctggatcgctggatcgaccaatccaagcag
tacgccggcaccccgatgtccgccgacagcgcgcgtgcgctgcaattactcaagctgatg
agcgccctgcccgccccgcgcgacccgaccaagctggccgaactcacgcgtatcgccgcg
aagatggaaggcgactacggcgcgggcagcgcctgcaccggtgaaggcgagcaacgccgt
tgccgccagctgggcgagctcgaacaagtgctggcacgcagccgcgactacgacgaacaa
ctgcaagcctggcaaggctggcacgccaccgcgcaacccatgcgcaaggactaccagcgc
tttgtcgagctcgccaatgacggtgcacgcggcatgggctttgccgatgtcggtgcgatg
tggcgcagcggctacgacatgccgccggcgcaattggccagcgaaaccgaccgcctttgg
gaacagctcaaaccgctgtacacccagctgcaatgctacgcgcgcggcaagctggacacg
cagtacggcaaggacaagggcgaggtggccggcggcatgctgcccgcgcacctgatgggc
aacatgtggcagcaggactggagcaacctgtgggatctgctgcagccctatcccggtgcg
ggcgacctggacatcacctcggcgctggaaaaacagtaccagggcaacctgagcgccgtg
ctggcgcgcaacaccggtggcgatggcggcgcagctgcacgcttcctcgccgagcgcgac
gcgcaactgcgcactgcccagcagatgaccgaacgcgcgcaggatttctacacgtcgctg
ggcatgccgaagttgccggacacctattggcaacgctcgcagttcatcaagccactggac
cgcgacgtggtctgccacgccagcgcgtgggacatgaacatgggtggcgagccgaacgcg
ggcatcggcccggacgtgcgcaccaagatgtgcatccgccccaccgaagaagacttcacc
accatctaccatgagcttggccacatctattacgacatggcctacaacccgttgccgccg
ctgttccagaacggcgccaacgacggcttccacgaagccatcggcgacaccatcgtgctg
gcgatgacccccaagtacctgcagtcgatcggcatggttggcgagcagcagagcgggcgc
gaggcattgatcaattcgcagatgcgcatggcgctgagcaaggtggcgtttctgccgttc
gggctgatgatcgaccgctggcgctggggcgtattcgacggctcgattcccccggaacgc
tacaaccaggcctggtgggagttgaaggccacctaccagggcgtggcaccggtgagccca
cgcggcgaggacttcttcgatgccggcgccaaataccacgtgcccggcaacacgccctac
acccgttattttctcgcgcacatcctgcaattccagttctacaagggcctgtgcgatgcc
gccggccaccaggggccgctgtacgaatgcagcttctacggcaacaaggaagccggccaa
aaattctggtcgatgttgcaacgcggctccagccagccctggcagaccacgctgaaggaa
gtgaccggcaaggacacgctcgatgccggcccgatgctggaatatttcgcaccgatgcag
gaatggctcaaacagcagaaccagggccagatgtgcgggtggcaggccaagggggccact
gcaacgccgccggcaacgccggcgccttccgcgcgctga

DBGET integrated database retrieval system