KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1116Help
Entry
XCC1116           CDS       T00083                                 

Definition
(RefSeq) dipeptidyl carboxypeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     XCC1116
Peptidases [BR:xcc01002]
 Metallo Peptidases
  Family M2
   XCC1116
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCC1116
CD molecules [BR:xcc04090]
 Proteins
  XCC1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1304070..1306088)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSSCRQDAVPTPKPATTKTAPSESADQFVARISAEYKAAYPE
MTAAQWLSSTYINGDSQLLAAKANERALSQLDRWIDQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPTKLAELTRIAAKMEGDYGAGSACTGEGEQRRCRQLGELEQVLARSRDYDEQ
LQAWQGWHATAQPMRKDYQRFVELANDGARGMGFADVGAMWRSGYDMPPAQLASETDRLW
EQLKPLYTQLQCYARGKLDTQYGKDKGEVAGGMLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLSAVLARNTGGDGGAAARFLAERDAQLRTAQQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEPNAGIGPDVRTKMCIRPTEEDFT
TIYHELGHIYYDMAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQSGR
EALINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSIPPERYNQAWWELKATYQGVAPVSP
RGEDFFDAGAKYHVPGNTPYTRYFLAHILQFQFYKGLCDAAGHQGPLYECSFYGNKEAGQ
KFWSMLQRGSSQPWQTTLKEVTGKDTLDAGPMLEYFAPMQEWLKQQNQGQMCGWQAKGAT
ATPPATPAPSAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtctgctgttgctggcgctcgccgttgccgccggtacgttgtcgctgtcg
tcgtgccgccaggatgcggtgccgacgcccaagcccgccaccaccaaaaccgcacccagc
gaaagcgccgaccagttcgtggcgcgcatcagtgccgaatacaaggcggcgtatccggaa
atgactgccgcgcagtggctgtcgtcgacctacatcaacggcgactcgcagttgctggcg
gccaaggccaacgagcgcgcgctgagccagctggatcgctggatcgaccaatccaagcag
tacgccggcaccccgatgtccgccgacagcgcgcgtgcgctgcaattactcaagctgatg
agcgccctgcccgccccgcgcgacccgaccaagctggccgaactcacgcgtatcgccgcg
aagatggaaggcgactacggcgcgggcagcgcctgcaccggtgaaggcgagcaacgccgt
tgccgccagctgggcgagctcgaacaagtgctggcacgcagccgcgactacgacgaacaa
ctgcaagcctggcaaggctggcacgccaccgcgcaacccatgcgcaaggactaccagcgc
tttgtcgagctcgccaatgacggtgcacgcggcatgggctttgccgatgtcggtgcgatg
tggcgcagcggctacgacatgccgccggcgcaattggccagcgaaaccgaccgcctttgg
gaacagctcaaaccgctgtacacccagctgcaatgctacgcgcgcggcaagctggacacg
cagtacggcaaggacaagggcgaggtggccggcggcatgctgcccgcgcacctgatgggc
aacatgtggcagcaggactggagcaacctgtgggatctgctgcagccctatcccggtgcg
ggcgacctggacatcacctcggcgctggaaaaacagtaccagggcaacctgagcgccgtg
ctggcgcgcaacaccggtggcgatggcggcgcagctgcacgcttcctcgccgagcgcgac
gcgcaactgcgcactgcccagcagatgaccgaacgcgcgcaggatttctacacgtcgctg
ggcatgccgaagttgccggacacctattggcaacgctcgcagttcatcaagccactggac
cgcgacgtggtctgccacgccagcgcgtgggacatgaacatgggtggcgagccgaacgcg
ggcatcggcccggacgtgcgcaccaagatgtgcatccgccccaccgaagaagacttcacc
accatctaccatgagcttggccacatctattacgacatggcctacaacccgttgccgccg
ctgttccagaacggcgccaacgacggcttccacgaagccatcggcgacaccatcgtgctg
gcgatgacccccaagtacctgcagtcgatcggcatggttggcgagcagcagagcgggcgc
gaggcattgatcaattcgcagatgcgcatggcgctgagcaaggtggcgtttctgccgttc
gggctgatgatcgaccgctggcgctggggcgtattcgacggctcgattcccccggaacgc
tacaaccaggcctggtgggagttgaaggccacctaccagggcgtggcaccggtgagccca
cgcggcgaggacttcttcgatgccggcgccaaataccacgtgcccggcaacacgccctac
acccgttattttctcgcgcacatcctgcaattccagttctacaagggcctgtgcgatgcc
gccggccaccaggggccgctgtacgaatgcagcttctacggcaacaaggaagccggccag
aaattctggtcgatgttgcaacgcggctccagccagccctggcagaccacgctgaaggaa
gtgaccggcaaggacacgctcgatgccggcccgatgctggaatatttcgcaccgatgcag
gaatggctcaaacagcagaaccagggccagatgtgcgggtggcaggccaagggggccact
gcaacgccgccggcaacgccggcgccttccgcgcgctga

DBGET integrated database retrieval system