KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1418Help
Entry
XCC1418           CDS       T00083                                 

Gene name
gst
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XCC1418 (gst)
Enzymes [BR:xcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XCC1418 (gst)
Transporters [BR:xcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   XCC1418 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1652775..1653410
Genome map
AA seq 211 aa AA seqDB search
MTTTLYHAPSTAALVVHWMLIELQVPHVLHPLDFDRREQKSPAYLALNPAGVVPTLVLEG
QVMTEAAAIVLHLADLHPQAGLAPPPGTPARAAYYQWMFFCANTLQPAFRAWFYPDEPAG
AEQVDAAQAQARQKLEAAWAQVDAHLQAHGPYLLGDTLSAADFLLTMLMRWSRNMPKPTD
TWPALHAHAQRMKARPAFRETYRREGLTDWT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgctgtaccacgcccccagcaccgccgccctggtcgtgcactggatgttg
atcgaactgcaggtgccgcacgtgctgcatccactggacttcgaccggcgcgagcagaaa
tcccccgcctatctcgcgctcaacccggcaggcgtggtgccgaccctggtgctggaggga
caggtgatgaccgaagcggcggccatcgtgctgcacctggccgacctgcacccgcaggcg
ggcttggcaccgccgccggggacgccggcacgcgcggcgtactaccagtggatgttcttc
tgcgccaacaccttgcagccggcgtttcgcgcctggttctacccggacgagccggccggc
gctgagcaggtcgacgccgcgcaagcgcaggcccggcagaaactggaggcggcctgggcg
caagtggacgcgcacctgcaggcgcacggcccgtatctgctgggcgacacgctatcggcg
gccgatttcctgctgaccatgctgatgcgctggtcgcgcaatatgcccaaacccacggat
acctggcccgccttgcacgcgcatgcccagcggatgaaggcgcggcccgccttccgggag
acctaccggcgcgagggcctgaccgactggacctga

DBGET integrated database retrieval system