KEGG   Xanthomonas citri subsp. citri UI6: J158_01006Help
Entry
J158_01006        CDS       T03894                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
xcj  Xanthomonas citri subsp. citri UI6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1043907..1045376)
Genome map
AA seq 489 aa AA seqDB search
MEALSETLRGIAARGPLGLFIDGQWRASTGDRTVDVIAPHTEERLLRYTEPSPSDTEAAI
AAARSAFDNGPWPQLSPQERSVVLKRVADHLRARMPELAEAWTGQVGATLGFSKRASQQA
PDLFDYYADLIATHAFVQPRVRPSGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKISFTG
STQAGRSIGIACAERLARVGLELGGKSAAIVLEDADLAKMLPTLVPYSMPIAGQVCFSLT
RVLVPTQRREEILQAYCTALSAVKLGDPFAADTGMGPLALGRQLERVQSYIAKGKAEGAR
LVMGGSRPAHLSRGFFVEPTVFAEVMPDMAIAREEIFGPVVSFIDYHDEADLIAKANASD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSGIGREGGIEGLHAF
LETRTLYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttgtccgaaacgctgcgcgggatcgccgcaaggggtccactgggcctgttt
atcgatgggcaatggcgcgcaagcaccggcgatcgcaccgtcgatgtgatcgcgccgcac
accgaagaacggctgctgcgctacaccgaaccctcgccctcagataccgaagcggccatc
gccgctgcacgcagcgcattcgacaacggcccctggccgcagctctccccgcaagagcgt
agcgtagtgctcaagcgggtggccgaccacttgcgcgcacgcatgccggagttggccgaa
gcatggacgggccaggtgggcgccaccctcggcttcagcaagcgcgcgtcgcagcaggcg
ccggatctattcgattactacgccgatctgattgccacccatgcattcgtccaaccgcgt
gtgcgccccagcggtggccgcgtgcatgtggtgcaggagccggttggcgtggtcgccgca
atcacgccctggaacgcgccgctggtattgctgtgctacaaggtcgccgccgcactggct
gccggttgcacggtggtggccaagccctcgccggagacaccgatcgatgcctatatcctg
gccgagtgcatcagcgccgccggcgtgcccgatggcgtgttcaacctgctccccgccggc
cgcgaggtgggcgagcaattgatccgccacccgcacgtcgacaagatcagcttcaccggc
tccacccaggccggtcgctcgatcggcatcgcctgcgccgagcgcctggcacgggttggc
ctggagctgggcggcaaatcggccgcaatcgtgcttgaagatgccgacctcgcgaagatg
ctgcccaccttggtgccttactccatgccgatcgccggacaggtgtgcttctcattgacg
cgcgtcctggtgccgacgcagcgccgcgaagaaatcctgcaggcgtattgcacggcactg
agcgcagtgaaactgggcgacccgtttgcggcagacaccggcatgggcccgttggccttg
ggccgccagctcgaacgtgtgcagtcctacatcgccaaaggcaaggccgagggcgcacgc
ctggtcatgggtggtagccgtccggcacacctgtcgcgcggcttctttgtcgaaccgacg
gtgtttgccgaggtgatgcccgacatggccattgcgcgcgaggaaatcttcggaccggtg
gtgagcttcatcgactaccacgacgaagccgacctcatcgccaaggccaatgccagcgac
tacggtttgcacggcaccatctacagcgaagacgccgaacgcgcctatcgcatcgcgcgc
cgcgtgcgcagcggcagtcatgcgatcaacggcatgtgggtagatatcagcatgccattc
ggtggcttcaagcactcgggcatcggccgcgaaggcggtatcgaaggcctgcatgccttc
ctcgaaaccagaaccctctacctgagctag

DBGET integrated database retrieval system