KEGG   Xanthomonas citri subsp. citri NT17: J169_01354Help
Entry
J169_01354        CDS       T03734                                 

Definition
(GenBank) Oligoendopeptidase F
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xcn  Xanthomonas citri subsp. citri NT17
Brite
Enzymes [BR:xcn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     J169_01354
Peptidases [BR:xcn01002]
 Metallo Peptidases
  Family M2
   J169_01354
Exosome [BR:xcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J169_01354
CD molecules [BR:xcn04090]
 Proteins
  J169_01354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1394452..1396470)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVATGTLSLSACRRDAAPPDKPVATKTAPAESADQFVARISAEYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNASGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEASQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSDWLKQQNQGQMCGWQATAAA
PVTTKTAPAAAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcattggctgtggctaccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacaaacctgtcgcgaccaagaccgcgccggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
accaccgctgcgcagtggctgtcgtccacctatatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagctggatcggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcagttgctcaaattgatg
agcgccctgcccgcaccgcgcgaccctgccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgccggcagctattgcgtgggcgaaggcgagcagcgccgc
tgccgccagctgggcgagttggagcaagtgctggccagcagccgcgactacaacgagcaa
ctcgacgcatggcagggctggcacagcactgcgcaacccatgcgcaaggactaccaacgc
ttcgtcgagctggccaatgagggcgcacgcgggctgggtttcgccgacgtcggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctatgg
gaacaggtcaaaccgttgtatgcgcagttgcagtgctatgcgcgcggcaaactcgacacg
caatacggcaaagacaagggcgaggtcgccggcggcctgttgccggcacatctgatgggc
aatatgtggcagcaggactggagcaatctgtgggatctgctgcagccctacccgggggcc
ggcgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcaccgcagtg
ctggcacgcaacgccagtggcgatggtggcgcggccgcacgcttcaacgccgaacgcgaa
gcgcagctgcgcaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacctattggcagcgctcgcagttcatcaagccgctggac
cgcgacgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgaggcgagccag
aacatcggcgcggatgtgcgcaccaagatgtgcatcaaaccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcctacaacccgttaccgccg
ctgttccagaacggcgccaacgatggcttccacgaagcgatcggcgacaccatcgtgctg
gcgatgacgcccaaatacctgcaatcgatcggcatggtgggcgagcaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggcgctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactcaaagccaagtaccagggcgtggcgccggtgagcgcg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacaccccgtac
acgcgttattttctggcgcatatcctgcaattccagttctacaaaggcctgtgccaggcc
gccggccatcaggggccgctgtacgagtgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcaacgtggttccagccaaccctggcaaaccacactcaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatacttcgcgccgatgagc
gactggctgaagcagcagaaccaggggcagatgtgcgggtggcaggcaacggctgccgct
ccggttacaacgaaaactgcgcctgctgcagctcgttga

DBGET integrated database retrieval system