KEGG   Xanthomonas campestris pv. raphani: XCR_0920Help
Entry
XCR_0920          CDS       T01872                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCR_0920
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     XCR_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(960186..961613)
Genome map
AA seq 475 aa AA seqDB search
MHATSRPCPRTFWQRAHQLLLIALTLLLTTASAQADVILHAFNWPYATVEARAKQIADAG
YRKVLVAPAYRSEGSAWWARYQPQDIRLIDNPLGDTTAFARMVQALANNGVETYADVVFN
HMANEAATRSDLNYPGSAVLAQYAANPGRYDALRLFGTVQSNFLSGSDFGPAQCISNYND
AFQVRNYRICGGGSDPGLPDLLGNDWVVQQQRAYLQALKGLGVTGFRVDAAKHMTFDHLN
RVFDAGIRSGVYVFGEVITGGGSGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFGVGA
SMQQLVDPASAGQALPGNRAVTFAVTHDIPNNAGFRYAILDPVDETLAYAYLLGRNGGVP
MVYTDNNESGDNRWVNAYLRDDLRRMIGFHNGVQGSDMQVLSSSACHILFRRGSLGIVGI
NKCGNPVNTTVAMNGSVLFWNADYVDALGSGNVVRISSGSYTFTLPARQARMWRR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccacctctcgcccctgtccacgcacgttctggcaacgcgctcaccagttgctg
ttgatcgcgctgaccttgttgctgaccaccgccagcgcacaggccgacgtcatcctgcat
gcgttcaactggccctacgccacggtagaagcgcgcgccaagcagatcgccgatgccggg
tatcgcaaggtactggtcgcaccggcgtatcgctccgaaggcagtgcctggtgggcgcgc
taccagccgcaggatatccgcctgatcgacaatccactcggcgacaccaccgcgttcgcg
cgcatggtgcaggcactggcaaacaacggtgtggaaacctatgccgacgtggtgttcaac
cacatggccaacgaagcagcaacgcgctcggacctcaattaccccggcagcgcggtgctg
gcgcagtacgcagccaatcctgggcgctacgatgcactgcgcctgttcggcacggtgcag
tccaactttttgagcggcagtgatttcgggccggcgcaatgcatcagcaactacaacgat
gccttccaggtgcgcaattaccgcatctgcggcggcggcagcgatccgggcctgccggat
ctgctcggcaacgattgggtggtgcagcagcagcgcgcctacctgcaggcgctcaagggc
ctgggcgtcaccggcttccgcgtggacgcggccaagcacatgaccttcgaccatctcaac
cgcgttttcgatgccggcatccgctccggtgtgtacgtgtttggtgaagtgatcaccggc
ggtggcagcggcaatggcgactacgaccagttcctggcgccgtatctgcaatccaccccg
catgccgcctacgatttcccgctgttcaacgcggtacgcaatgccttcggtgtgggtgcg
agcatgcaacagttggtggacccggcgtccgccgggcaggccttgccgggcaaccgtgca
gtcacctttgccgtgacgcatgacatccccaataacgcaggcttccgctacgcgattctc
gacccggtcgatgaaacgctggcctatgcgtacttgctgggccgcaacggcggcgtgccg
atggtctacaccgacaacaacgaaagcggcgacaaccgctgggtcaatgcctatctgcgc
gatgatctgcgccgcatgattggcttccacaacggcgtgcagggcagcgacatgcaggtg
ctgtcatccagtgcctgccacatcctgttccgccgcggcagcctcggcatcgtgggcatc
aacaagtgcggcaacccggtcaacaccaccgtcgccatgaacggcagcgtgttgttctgg
aatgcggattacgtcgatgcactgggttccggcaacgtggtgcgcatctccagtggctcg
tacaccttcaccctgccggcgcggcaggcgcgtatgtggcgacgttga

DBGET integrated database retrieval system