KEGG   Xanthomonas campestris pv. raphani: XCR_0989Help
Entry
XCR_0989          CDS       T01872                                 

Definition
(GenBank) betaine aldehyde dehydrogenase
Organism
xcp  Xanthomonas campestris pv. raphani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1033418..1034887)
Genome map
AA seq 489 aa AA seqDB search
MEALAATLRGIAARGPLGLFIDGQWRASTGRQTLDVVAPHTEERLLRYTEPSHADTEAAV
AAARRAFDSGPWPQLPPPERGAALKRIAEHLRARMPELADAWTAQVGATIGFSRRASKQA
PDLFDYYGDLITTHPFVEPRTRSSGGRVHVVQEPVGVVVAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGLPDGVFNLLPAGREVGEQLIRHPSVDKVSFTG
STQAGRSIGVACAERLARVGLELGGKSAAIVLEDADIEKMLPSLVPYSMPITGQVCFALT
RVLVPAHRREAILQVYCSALATLKLGDPFAADTGMGPLALGRQLERVQGYIAQGSAEGAK
LVMGGGRPEHLPRGFFLEPTVFAGVTPEMTIAREEIFGPVVSFIDYHNEEDLIAKVNDSD
YGLHGTVYSDDPERAYAIARRVRSGSHSINGMCVDIEMPFGGVKHSGIGREGGIEGLHGF
LETKTIYLG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttagccgcgaccctgcgtggcatcgccgcgcgtggaccgttgggactgttc
attgatggtcagtggcgcgccagcaccggccgccagacgctggatgtcgtcgcgccgcac
accgaagaacgcctgctgcgctacaccgaaccatcgcatgctgacaccgaggccgcggtt
gccgcggcgcgcagagccttcgatagtggcccctggccgcagctgccgccgccagaacgc
ggcgccgcgctcaagcgcattgccgagcatttgcgggcgcgcatgccggaactggcagat
gcatggaccgcgcaggtcggcgccaccatcggtttcagtcggcgcgcctccaagcaggcg
ccggatctgttcgactattacggcgacctgatcaccacccacccgttcgtcgagccacgc
acgcgctccagcggtggacgcgtgcacgtggtgcaggaaccggtcggcgtggtcgttgcc
atcacgccgtggaacgcgccgttggtgctgctctgctacaaggtcgccgccgcgctggcg
gccggctgcaccgtggttgccaagccgtctccggaaacgccgatcgacgcctatattctg
gccgaatgcatcagcgccgccgggctgccggatggcgtgttcaatttgctcccggccggg
cgcgaggtgggtgaacagctgatccggcacccttcggtggacaaggtgagcttcaccggc
tccacccaggcagggcgatcgatcggtgtggcctgcgccgagcggctggcgcgcgtcggg
ctggagctgggcggcaagtcggcggcgatcgtgctggaggatgccgacatcgagaaaatg
ctgcccagcttggtgccctactcgatgccgatcaccggccaggtgtgtttcgcgctcacc
cgcgtactggtccccgcgcatcggcgcgaggccatcctgcaagtgtattgctcggcgctg
gccacgctcaaactcggcgacccgtttgccgccgacacgggcatgggcccgctggcactc
ggccgccagttggaacgtgtgcaaggctacatcgcccagggcagcgccgaaggcgcaaag
ctggtcatgggcggcgggcggccagagcacttgccacgcggtttctttcttgagccgacc
gtgtttgcaggtgtgacgccggagatgaccattgcccgcgaagaaatcttcggccccgtc
gtgagttttatcgactatcacaacgaagaagatctgatcgccaaagtcaacgacagcgat
tacggcctgcatggcaccgtctatagcgacgatcccgaacgcgcctacgcgattgcgcga
cgcgtgcggagcggcagccattcgatcaacggcatgtgcgtggatatcgagatgccgttc
ggtggtgtcaaacactccggcatcggccgcgaaggtggcatcgaaggcctgcacgggttt
ctcgaaaccaaaacgatctatctcggctaa

DBGET integrated database retrieval system