KEGG   Xanthomonas campestris pv. vesicatoria: XCV0917Help
Entry
XCV0917           CDS       T00288                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV0917
   00053 Ascorbate and aldarate metabolism
    XCV0917
   00620 Pyruvate metabolism
    XCV0917
  Lipid metabolism
   00071 Fatty acid degradation
    XCV0917
   00561 Glycerolipid metabolism
    XCV0917
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCV0917
   00310 Lysine degradation
    XCV0917
   00330 Arginine and proline metabolism
    XCV0917
   00340 Histidine metabolism
    XCV0917
   00380 Tryptophan metabolism
    XCV0917
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XCV0917
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XCV0917
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XCV0917
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XCV0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1046781..1048250)
Genome map
AA seq 489 aa AA seqDB search
MEALFETLRGIAARGPLGLFIDGQWRASTGDRSVDVIAPHTEERLLRYTEPSHADTEAAI
AAARRAFDHGPWPQLSPQARSVALKRVADHLRARMPELAEAWTGQVGATLGFSKRASQQA
PDLFDYYADLIATHAFVEPRVRPNGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKVSFTG
STQAGRSIGIACAERLARVGLELGGKSAAIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRREEVLQAYCAALSAVKLGDPFAEDTGMGPLALGRQLERVQSYIAKGKAQGAR
LAMGGGRPAHLSRGFFVEPTVFAEVTPDMTIAREEIFGPVVSFIDYHDEADLIAKAKASD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTLYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttattcgaaacgctgcgcggcatcgccgcgcgaggtcccctgggtctgttc
atcgacgggcaatggcgcgcaagcaccggcgatcgctcggtcgatgtgatcgcgccgcat
accgaagaacggctgctgcgctacaccgaaccctcgcacgcagataccgaagcggccatc
gcagctgcacgccgcgccttcgaccacggcccctggccgcagctctccccgcaagcgcgc
agcgtggcactcaagcgggtggccgaccacttgcgtgcacgcatgccggagttggccgaa
gcatggacgggccaggtcggcgcgacccttggcttcagcaagcgcgcctcgcagcaggcg
ccggatttattcgactactacgccgacctgattgccacccacgcattcgtcgaaccacgt
gtgcgccccaacggtggccgcgtgcatgtggtgcaggagccggtcggcgtggtcgccgcg
atcacgccctggaacgcgccgctggtattgctgtgctacaaggtcgccgccgcgctggct
gccggctgcacggtggtggccaagccctcgccggaaacgccgatcgatgcctatatcctg
gccgagtgcatcagcgccgccggcgtgcccgatggcgtgttcaacctgctccccgccggc
cgcgaagtgggcgagcaattgatccgccacccgcacgtggacaaggtcagcttcaccggc
tccacccaggccggccgctcgatcggcatcgcctgcgccgagcgcctggcacgggttggc
ctggagctgggcggtaaatcggcagcaatcgtgctggaggacgccgacatcgccaaggtg
ctgcccaccctggtgccctactccatgccgatcgccggacaggtgtgcttctcgttgacg
cgcgtcctggtgccggcgcagcgccgcgaagaagtcctgcaggcatattgcgcggcattg
agcgcagtgaagctgggcgacccgtttgcggaagacaccgggatgggcccgttggccctg
ggccgccagctcgaacgtgtgcagtcctacatcgccaaaggcaaggcgcagggcgcacgc
ctggccatggggggaggccgcccggcacacctgtcgcgcggcttcttcgtcgaaccgacg
gtgtttgccgaggtgacgccggacatgaccattgcgcgcgaggaaatcttcggaccggtg
gtgagcttcatcgactaccacgacgaagccgacctgatcgccaaggccaaagccagcgac
tacggcctgcacggcaccatctacagcgaagacgccgaacgcgcctatcgcatcgcgcgc
cgcgtgcgcagcggcagtcatgcgatcaacggcatgtgggtcgatatcagcatgccgttt
ggtggcttcaagcactcgggtatcggccgcgaaggcggtatcgaaggtctgcatgccttc
ctcgaaaccaaaaccctctacctgagctag

DBGET integrated database retrieval system