KEGG   Xanthomonas citri subsp. citri MN10: J162_01604Help
Entry
J162_01604        CDS       T03779                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
xcw  Xanthomonas citri subsp. citri MN10
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcw00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    J162_01604
Enzymes [BR:xcw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     J162_01604
Transporters [BR:xcw02000]
 Other Transporters
  Pores ion channels [TC:1]
   J162_01604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1688665..1689300
Genome map
AA seq 211 aa AA seqDB search
MVATLYHSPSTAALVVHWLLIELDIPHALHPLDFERGEHKSPQYLALNPAGVVPTLVLDG
QVLTEAAAIVLQLADLHPQAGLAPAVGTPERAAYYKWMFFCANTLQPAYRAWFYPSEPAG
AGQAEAAQMHARRKLEAAWTQVDAHLQAHGPYLLGKTVSAADFMLTMLMRWSRNMPRPTD
TWPALRAHAMQMKARPAFQETYRREGLTDWT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccacgttgtaccactcccccagcaccgcagcgttggtggtgcattggctgctg
atcgaactggatatcccgcacgcactgcacccgctggatttcgaacgcggcgaacacaaa
tcgccgcagtatctggcgctcaatccggccggcgtggtgcccacgctggtgctcgacggc
caagtgctcacggaagccgcagccatcgtgctgcagctggccgatctgcatccccaggcc
gggctggccccggcagtcggcacgcccgagcgtgcggcgtactacaagtggatgttcttc
tgcgccaacaccctgcagccggcgtaccgcgcctggttctatccgagcgagcctgccggg
gccgggcaggccgaggcggcgcagatgcacgcccgccgcaagctcgaagcggcctggacc
caggtcgatgcgcatctgcaggcccatggcccgtatctgctcggcaagaccgtgtcggcg
gccgatttcatgttgaccatgctgatgcgctggtcgcgcaacatgccgcggccgaccgat
acctggccggcgctgcgggcgcacgcaatgcagatgaaggcgcgcccagcattccaggaa
acctatcgccgggaaggcctgacggactggacctga

DBGET integrated database retrieval system