KEGG   Xanthomonas gardneri: BI317_01500Help
Entry
BI317_01500       CDS       T04668                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xga  Xanthomonas gardneri
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BI317_01500
  Lipid metabolism
   00600 Sphingolipid metabolism
    BI317_01500
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BI317_01500
Enzymes [BR:xga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BI317_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
348370..351150
Genome map
AA seq 926 aa AA seqDB search
MRVEMWCALKRRVAESSVRLAQVMFVCLCATLPVLPALAVPPAPTEMPRERVSLNAQWRF
HRGDPPGNRETLDYDVRPQVVRSEDGKVADAQPEQAQHIDAAATRVLKPWILPTANNLIA
DPAKRHKRPPGNPGGTVAFVQPQFDDSGWEPVDLPHDWAIAGPFLADGPYGGMGRLPSWG
IGWYRKSLDIPVSDRGRSLFLDLDGAMAYATVWLNGKLVGGWPYGYSSWRVDLSSYVVFG
ARNQLAIRLDNPPDSARWYPGGGLYRNVWLTKAAPLHIAQWGTQLTTPQVSADTAQVQLA
ITLENAARSAVQAQVSTAIYVLDDVRGTRSGEPVARIAPVQVAVPATGSARVQGTTQIDQ
PRLWGPPPTQRPHRYIAVTEVSQNGRVVDRYDTPFGIRSIVFDAGKGLLVNGEHVPIRGV
NNHHDLGALGAAFNLRAAERQLQLQQQMGANAIRMSHNPPAPELLELTDRMGLLVVDEVF
DSWEMKKTPLDFHLVFPQWHEPDLRAMLRRDRNHPSVMLWSVGNEVGEQYTGEQGAAIAR
TLHAIVYDEDSTRPATVAMNYASPEMPLPAALDVISLNYQGEGIRDMPEFAGTERIRKQP
QYPAFHSKFPHKAILSSETASALSSRGVYLFPVTPDNSAPVRDGRGGDSATHQVSAYELH
AVDFGSSADKVFAAQDRHPYVAGEFVWTGFDYLGEPTPYYSSRSSYSGIFDLAGFPKDRY
WLYQSRWRPDLPMAHLLPHWTWPGREGQLTPVHVFTSGDEAELFVNGVSQGRKRKAPLQY
RLRWDEVVYHPGELRVQAYKDGKPWASDRVQTAGTAARMQVTPDRSSIRGDGQDLSFVTV
RLLDRDGRPAPTAGDRLRFRIEGPGELVATDNGDPTNLESFVSQQRNAFNGLSLAIVRAK
AGARGTITVHVESDTLQAGSAQVVVE
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtagagatgtggtgcgcgctgaagcgccgtgttgccgaaagcagcgtgcgtctt
gcacaggtgatgttcgtctgcctctgcgccacgcttcctgtgttgcccgcactggcggta
ccaccggcgccaaccgagatgccacgcgagcgtgtctcgctcaacgcgcaatggcgcttc
caccgcggcgatccccctggcaatcgcgaaaccctggactacgatgtgcgtccgcaagtg
gtgcgtagcgaagacggcaaggtggccgatgcacaacccgagcaggcgcagcacatcgat
gccgccgcaacacgcgtgctcaagccgtggatcctgcctactgccaacaacctgattgca
gatcccgcgaaacgacacaaacgcccgcccggcaatcccggcggcaccgttgccttcgtg
cagccgcagttcgacgacagcggttgggagccggtggacctgccgcacgattgggcgatt
gccgggccgttcctggccgatggcccttacggcggcatggggcgcttgcctagctggggc
atcggttggtatcgcaaaagcctggacattcctgtcagcgatcgcggccgctcgctgttt
ctcgatctcgatggcgcgatggcgtatgccacggtctggctcaacggcaagctggtcggc
ggttggccgtatggctacagctcctggcgcgtggacctgagctcgtacgtggtgttcggt
gcacgcaaccagctggcgattcgtctggacaacccgcccgactcggcacgctggtatccg
ggtggcgggctgtatcgcaatgtgtggttaaccaaagctgctccgctgcatatcgcccaa
tggggcacgcagctgaccacgccgcaggtgtcggcagacactgcgcaggtgcagctagcg
atcacgctggagaatgccgcccgcagcgctgtgcaagcgcaagtcagtaccgcgatctat
gtgctcgatgatgtgcgtggcacgcgcagtggtgagcctgttgcacgcattgcgcctgtg
caggttgcggttcccgcaacgggtagcgcacgcgtgcaaggcactacgcagatcgatcaa
ccacgtctgtggggcccgccaccaacacagcgcccgcatcgctacatcgccgtgaccgaa
gtcagccagaacgggcgcgtggtggatcgctatgacacaccgttcggcatccgcagcatc
gtgttcgatgccgggaaggggctgctggtcaacggcgaacatgtgccgattcgcggcgtg
aacaatcatcacgatctcggtgcgctgggtgcagcgttcaatctgcgcgccgccgagcgg
caactgcagttgcagcagcagatgggcgccaacgccatccgcatgagccacaacccgccc
gcgcccgagctgttggagttgaccgaccgcatgggcctgctggtggtggatgaagtgttc
gacagttgggagatgaagaagaccccgctggatttccacctggtgttcccgcagtggcac
gaaccggacctgcgcgcgatgctgcggcgcgaccgcaatcatccctcggtgatgctgtgg
agcgtgggtaacgaagtcggcgagcaatacaccggcgagcagggcgccgcgatcgcccgc
acgctgcatgccatcgtgtacgacgaagactccactcgcccggctactgtggcgatgaac
tacgcctcgcccgagatgccgttgcccgctgcgctggatgtcatcagcctcaactatcag
ggcgaaggcattcgcgacatgccggagttcgcaggcaccgagcgcatccgcaaacagccg
cagtatccggcgtttcatagcaagtttccgcacaaagcgattctcagtagcgagaccgca
tcggccttgagcagccgtggcgtgtatctgtttccggtgacgccggataacagcgcaccg
gtgcgcgatgggcgcggcggcgactcagccacgcatcaggtcagcgcctacgaactgcat
gcggtggacttcggttccagcgccgacaaggtgttcgctgcacaggaccggcatccatat
gtggccggcgaattcgtctggaccggcttcgactacctgggcgaacccacgccgtactac
agctcgcgcagttcctactccggcatcttcgatctggccggttttcccaaggatcgttac
tggctgtatcaatcgcgctggcgccctgacctgccgatggcgcatctgttgccgcactgg
acctggcccggtcgcgaggggcagctcacgccggtgcatgtgttcacctcgggcgatgag
gccgagctgttcgtcaacggcgtgtcgcaggggcgcaagcgcaaggcgcccctgcagtat
cggttgcgctgggatgaggtggtctaccaccctggcgaactgcgtgtgcaggcgtacaag
gatggcaagccctgggccagcgaccgtgtgcagaccgccggcaccgccgcgcgcatgcag
gtgacgcccgatcgcagcagcatccgtggcgacgggcaggatctgagtttcgtcaccgta
cgtctgctcgatcgcgatgggcgccctgcaccaaccgccggcgaccgtctgcgtttccgc
atcgaaggaccgggtgagttggttgccaccgacaacggcgatccgaccaatctggaatcg
ttcgtttcgcagcaacgcaacgccttcaacgggctaagtctggccatcgtgcgcgccaag
gccggcgcacgtgggacgatcacggtccatgtcgagtccgacaccttgcaagcgggcagt
gcgcaggtggtggtggagtga

DBGET integrated database retrieval system