KEGG   Xanthomonas gardneri: BI317_07085Help
Entry
BI317_07085       CDS       T04668                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xga  Xanthomonas gardneri
Brite
Enzymes [BR:xga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BI317_07085
Peptidases [BR:xga01002]
 Metallo Peptidases
  Family M2
   BI317_07085
Exosome [BR:xga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BI317_07085
CD molecules [BR:xga04090]
 Proteins
  BI317_07085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1537771..1539795)
Genome map
AA seq 674 aa AA seqDB search
MNPRLLLLALTVAAGTLSLSACRQDAAPPAKPAATKAAPAESADQFVARISAEYKAAYPE
LTAAQWLSSTYINGDSQLLAAKANERQLAQLDRWIEQSKQYAGLPMSADSARALKLLTLM
SALPAPHDPTKLAELTQIAAKMEGDYGAARYCIGEGEQRRCRQLGELEQVLARSRDYNEQ
LDAWQGWHATAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDMQYGKDKGEVAGGMLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITAALEKQYQGNLSAVLARNVANTGEGGSGARFQAEREAQLRTAKQMTERAQEFYT
SLGMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEANQNIGADVRTKMCINPTEED
FTTIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQT
GREALINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPA
SARGEEFFDAGAKYHVPGNTPYTRYFLAHILQFQFYKVLCEAAGHQGPLYECSFYGNKDA
GQKFWSMLQRGSSQPWQTTLKELTGNDRLDAGPMLEYFAPMNAWLKQQNQGQLCGWQATA
PAAPANAPAPAATR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgcttttgctggcattgactgtcgctgccggcaccctgtcgttgtcg
gcctgccgccaggatgcggccccgccggccaaacccgccgccaccaaggccgcgcctgcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaagccgcgtatccggaa
ctcaccgcagcgcagtggctgtcgtcgacctatatcaatggcgactcgcagttgctggcc
gccaaggccaacgaacgccagctggcgcagctggatcgctggatcgaacaatccaagcaa
tacgccggcctgccgatgtcggccgacagcgcgcgcgcgttgaaattactgacattgatg
agcgccctgcccgccccacacgacccgaccaagctggccgaactgacccagatcgccgcc
aagatggaaggcgattacggcgcggcgcgctactgcatcggcgagggcgaacagcgccgc
tgccgccagttgggcgagctggaacaggtgctggcgcgcagccgcgactacaacgaacaa
ctcgacgcctggcaagggtggcacgccaccgcgcaacccatgcgcaaggattaccagcgc
tttgtcgagctcgctaatgaaggcgcacgcgggctcggttttgccgatgtcggtgtgctg
tggcgcagcggttacgacatgccgccagcgcagctggccagcgaaaccgaccgtctgtgg
gagcaggtcaaaccgctgtacgcgcaactgcaatgctacgcacgcggcaagctcgatatg
cagtatggcaaggacaagggcgaggtcgccggcggcatgttgcccgcgcatctgatgggc
aacatgtggcagcaggactggagcaacctgtgggatctactgcagccgtatccgggcgcc
ggcgatctggacatcaccgctgcgctggaaaaacaataccagggcaatctgagcgcggtg
ctggcacgcaacgtggccaataccggcgaaggcggtagcggtgcacgcttccaggccgag
cgcgaagcgcaactgcgcaccgcaaaacagatgaccgaacgcgcgcaggagttctacacc
tcgctcgggatgcccaaacttcccgacacctattggcaacgctcgcagttcatcaaaccg
ctggatcgcgacgtggtctgtcacgccagcgcgtgggatatgaacatgggcggcgaggcg
aaccagaacatcggcgcggacgtgcgtaccaagatgtgcatcaacccgaccgaagaagac
ttcaccaccatctatcacgagcttggccacatctattacgacctggcctataacccgctg
ccgccgctgttccagaatggcgccaacgatggcttccacgaagcgatcggcgacaccatc
gtgctggcgatgacgcccaagtatctgcagtcgatcggcatggtgggcgaacagcaaacc
ggccgcgaggcgctgatcaattcgcagatgcgcatggcactgagcaaggtcgccttcctg
ccgttcggcttgatgatcgaccgctggcgctggggggtgttcgatggctcgatcacgccg
gagcattacaaccaggcctggtgggaactcaaggccaagtaccagggcgtcgcgccggca
agcgcgcgcggcgaagagttcttcgatgccggcgccaaataccatgtgcccggcaatacg
ccgtacacccgttattttcttgcgcacatcctgcagtttcagttctacaaggtcctgtgc
gaagccgccggccatcaggggccgctgtacgaatgcagcttttacggcaacaaggacgcc
gggcagaaattctggtcgatgctgcagcgtggctccagccaaccgtggcaaaccacgctg
aaggaactcaccggcaacgaccgcctggatgccggcccgatgctggaatatttcgcaccg
atgaacgcgtggttgaagcagcagaatcaggggcagctgtgtggctggcaggcgactgcg
cccgctgcacccgccaacgcgcctgcgcctgctgcaacgcgctga

DBGET integrated database retrieval system