KEGG   Xenorhabdus hominickii: A9255_15840Help
Entry
A9255_15840       CDS       T04538                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xho  Xenorhabdus hominickii
Pathway
xho00564  Glycerophospholipid metabolism
xho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xho00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A9255_15840
Enzymes [BR:xho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A9255_15840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N HI0933_like FAD_oxidored Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AOM41898
UniProt: A0A2G0QF86
LinkDB All DBs
Position
complement(3454969..3456474)
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEGQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLNLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDNLGKRVSLPGS
KGLKFGAHSVLKPSITRGFEYSDCWVDDARLVVLNAQEVQKYGSEVRTRTQVTRAWREDG
YWMVEAKDLTTGKTDKWRAKGLVNATGPWVKNFFDNGLQLKSPYGIRLIKGSHIVVPRVH
DEPQAYILQNEDNRIVFVIPWNNDFSIIGTTDVEYKGDPKEVKINEQEIDYLLKVYNDHF
KKQLGRDDVVWTYSGVRPLCDDESDSPQAITRDYTLDIQDEQGQMPLLSVFGGKLTTYRK
LAEHAMEKLVQYYPNAGKAWTKNGKLPGGELEGYDRDGYARLLRQRHNWLPEGVALRYAR
TYGSNSQIILKGAESLTNLGEFFGHGLYEAELRYLVEHEWVTQLDDAIWRRTKLGMWLTD
EQKQRVADWLAQNTKATQQQS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgattgtaatcggcggcggaattaacggcgctggtattgcggca
gatgctgctggacggggactttctgtcctgctgttggaaggtcaagacttggccagtgcg
acttcctcggccagctccaagttgatccacggcggcttacgctatctggaacattatgaa
tttagactggtgagtgaagccctcgctgaacgtgaggtattattgaatctggctcctcat
attgcattcccaatgcgttttcgcttgccacaccagccacacctacgcccagcatggatg
atccgtatcggtttattcttgtacgataacttaggcaaacgcgttagccttccgggcagt
aaagggcttaaatttggtgcacactcggtattgaaaccatctatcacccgtggctttgaa
tattccgactgttgggttgatgatgcgcgtctggtagtcctgaatgcgcaagaagttcaa
aaatacggcagtgaagtacgcactcgcactcaagtgacccgtgcatggcgtgaagatggt
tactggatggtcgaagccaaagatctcactacgggcaaaaccgataaatggcgtgcgaag
ggcttagtcaacgcaactggcccatgggtgaaaaactttttcgataatggtctgcaactg
aaatcaccctatggcatccgcctgatcaagggcagccatattgttgttcctcgcgttcac
gatgagccgcaagcgtatattctacaaaacgaggataaccgcatcgtgtttgtgattccg
tggaataacgatttttctatcatcggcacaaccgatgttgaatacaaaggcgatccaaaa
gaagtcaaaattaacgagcaagagatcgactatttgctgaaagtctataacgaccacttc
aaaaaacaactgggccgcgatgatgttgtctggacttattctggcgttcgcccactgtgc
gatgatgaatctgactctccgcaagcgatcactcgtgactacacactggatattcaggat
gagcagggccagatgccattactgtccgtgtttggtggaaaactgacgacttatcgtaaa
ctggctgagcacgccatggagaaactggttcagtactatccaaatgcaggcaaagcatgg
actaaaaatggcaaattgccgggcggtgagctggaaggctatgaccgcgatggttacgca
cgtctgctgcgccagcgccataattggttacctgaaggcgtggcgctgcgttatgcccgt
acttacggcagcaacagccaaatcatcctgaaaggcgcggaatcgctgaccaatcttggc
gaattctttggtcatggcttatatgaagctgagttgcgttatttggttgaacacgaatgg
gtaacccagttggatgatgctatctggcgtcgcaccaagctaggtatgtggctcaccgat
gagcaaaaacaacgtgtagctgattggctggcacaaaacaccaaagctactcagcaacaa
agctaa

DBGET integrated database retrieval system