KEGG   Xenopus laevis (African clawed frog): 100036885Help
Entry
100036885         CDS       T01010                                 

Gene name
alpi.1.L, alpi.1
Definition
(RefSeq) alkaline phosphatase, intestinal, gene 1 L homeolog
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00730  Thiamine metabolism
xla00790  Folate biosynthesis
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100036885 (alpi.1.L)
   00790 Folate biosynthesis
    100036885 (alpi.1.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100036885 (alpi.1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100036885 (alpi.1.L)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xla00537]
 Enzymes
  100036885 (alpi.1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme DUF4363
Motif
Other DBs
NCBI-GeneID: 100036885
NCBI-ProteinID: NP_001091135
Xenbase: XB-GENE-866568
UniProt: A1L2L6
LinkDB All DBs
Position
7L
AA seq 530 aa AA seqDB search
MGYLVCLSWLLLWLCTARTQYATIPEEENKAEFWNSKMISRIDEALKLKPIKHRAKNLIL
FLGDGMGVPTVTATRILSGQMKSMLGEENELAMDKFPYIALSKTYNVDRQVPDSAGTATA
YLCGVKGNYGTVGVTAAVKRSNCSNIKGNEVESVLKKAKAAGKSVGIVTTTRVQHASPSG
TYANTPDRNWYSDGDMPANAVEAGCKDIAHQLISNVDIDVILGGGRKYMTPVGTPDPEYP
ADSKQNGIRKDGKNLIEEWLQKNKGAQYVWNKEQLDKIDVSSATHVMGLFEPSDMKYELN
RNTTTDPSIVELTEIAIRLLQRNPKGFYLFVEGGRIDHGHHDGKAKQALTEGVMFDRAID
KADQLTNEIDTLTVVTADHSHVFSFGGYTYRGSSIFGLAPKKAFDNKYYTSILYGNGPGF
NRTDQGRPNVNSNLSEDVNYMQQAAVPLDSETHGGEDVAIFSKGPMSHLFHGVQEQTYVA
HVMAYAACLPSYKDCPSQNNNASTTKASAALLLMPALWLLISAIHVGFIF
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgggataccttgtgtgcctgagctggttgcttctctggctttgcacagctaggacccaa
tatgccactattccagaggaagagaacaaagctgaattttggaacagcaaaatgatatcc
aggattgatgaagccctaaagctaaagcccattaagcacagagctaagaacctgatactc
ttcttaggtgatggaatgggggttccaacagtcactgccaccagaatcttaagtggtcag
atgaagagcatgctgggagaagagaatgagctggcaatggacaagttcccctacattgca
ctttctaagacgtacaatgtggatcggcaggttcctgacagcgctggtacagccactgct
tatctctgtggagtgaaaggcaactatggaacagtcggagtgactgcagctgtcaaacgt
tctaactgcagcaatatcaaaggcaatgaggttgaatcggttctcaagaaagcaaaggcc
gcaggaaaatctgtaggaattgtcactacaacacgagtccagcacgcttccccttccggc
acttatgctaacactcctgatcggaattggtacagtgatggcgacatgcccgcaaatgct
gtagaggctggctgtaaagatattgcccatcagctgatttcaaacgtggacattgatgtc
attcttggaggtgggcgaaaatatatgactccagtgggaacacctgatcctgagtaccct
gcagacagcaagcaaaatggtataagaaaagatgggaagaaccttatagaagaatggctt
cagaaaaacaagggagctcaatatgtgtggaacaaagaacaactggataaaattgatgtc
tcctccgcaacacatgtgatgggtttgtttgagccatcagatatgaaatatgagttgaac
cgcaatactaccactgacccatccattgtggagctaacggaaatagctatccgtctccta
cagaggaaccccaagggattttacctctttgttgaaggtggaaggatagaccatgggcat
cacgatggaaaagccaaacaggcactaactgagggagtgatgtttgacagggctatcgat
aaagcagatcaactaaccaatgaaatagatacgctgactgtggtgactgctgaccattcc
catgtcttcagctttgggggctatacttatagaggaagcagcatatttggtctggctcct
aagaaggcttttgacaacaagtattacacgtccattctttatggtaatgggcctgggttc
aacagaactgaccaaggacgaccaaatgtgaatagcaatctgagcgaggacgttaactat
atgcagcaggcggcagtacccttggattctgaaactcatggtggagaagacgtggccata
ttctcaaaggggcctatgtcacatttatttcatggagtccaggagcagacatatgtagcc
catgtcatggcatatgcagcttgtttgccttcctacaaagactgtccttcccaaaacaat
aatgcttccacaaccaaagcaagtgctgctctgcttctgatgcctgctctctggctgctc
atttctgccatacatgttggtttcatattttga

DBGET integrated database retrieval system