KEGG   Xenopus laevis (African clawed frog): 100381107Help
Entry
100381107         CDS       T01010                                 

Gene name
gad2.L, GAD65, gad2
Definition
(RefSeq) glutamate decarboxylase 2 L homeolog
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00250  Alanine, aspartate and glutamate metabolism
xla00410  beta-Alanine metabolism
xla00430  Taurine and hypotaurine metabolism
xla00650  Butanoate metabolism
xla01100  Metabolic pathways
Module
xla_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100381107 (gad2.L)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100381107 (gad2.L)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100381107 (gad2.L)
   00430 Taurine and hypotaurine metabolism
    100381107 (gad2.L)
Enzymes [BR:xla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100381107 (gad2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 100381107
NCBI-ProteinID: XP_018122730
Xenbase: XB-GENE-976601
LinkDB All DBs
Position
6L
AA seq 398 aa AA seqDB search
MVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREMIGWPGGSGDGIFSPGGAISN
LYAMLIARFKMFPEVKEKGMAALPRLVAFTSEHSHFSVKKGAAALGIGTDSVILIKADER
GKLIPSDLERRIIEAKQNGYVPFFVSATAGTTVYGAFDPLISIADICKKYQIWMHVDAAW
GGGLLMSRKHRWKLNGADRANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLF
QQDKHYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTTGFEAHIDKCLELSEYLYNIIKN
REGYEMVIEGKPQHTNVCFWYVPPSLRNMEDNEEKMNRLSKVAPTIKARMMEYGTTMVSY
QPHGDKGNFFRMVISNPAAAHQDIDFLIEEIERLGQDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggttggattagctgcagactggttgacatcaactgcaaatacaaacatgtttacctat
gaaattgcacctgtttttgtacttttggaatatgttacattaaagaaaatgagagagatg
attggatggcccggaggaagtggcgatggcatattctcacctggtggtgccatatctaac
ttgtatgctatgttgattgcacgtttcaagatgttcccagaggttaaagagaaaggaatg
gcagcattacccagactggttgccttcacatcagaacatagtcacttttctgttaagaaa
ggagcggcagccttggggattggcacggacagtgtgatccttatcaaagccgatgaaagg
gggaaactgataccatcagatcttgaaagacgaattatcgaagccaaacaaaatggatat
gttccattcttcgttagcgccactgccggaactacagtttatggagcatttgacccccta
atatctatcgccgacatctgcaaaaagtaccagatttggatgcatgtagatgctgcatgg
ggcggtggattactgatgtctaggaagcatcgatggaagcttaatggagctgacagggct
aattctgtgacgtggaatccacacaaaatgatgggcgttccactccagtgctctgcattg
ctggtcagggaagaggggctgatgcagaactgcaaccagatgcatgcatcctacctcttc
cagcaagacaaacactatgacctttcctatgacacgggagacaaggctttgcagtgcgga
cgccatgttgatattttcaagttgtggctaatgtggagagccaaagggacgactggattt
gaagctcatattgataaatgtctggagctgtcagaatatttgtataatataataaagaat
agagaaggctatgaaatggtgatcgaaggaaagccccagcacacaaatgtatgtttctgg
tatgtaccaccaagtttacgcaacatggaagacaatgaagaaaaaatgaatcggcttagt
aaggttgcccctaccatcaaagccaggatgatggagtacggaaccaccatggtcagctat
cagccacacggagacaaagggaattttttccgcatggttatctccaacccagctgcagcc
catcaagacattgacttcctgattgaagaaattgagcgccttgggcaagatttataa

DBGET integrated database retrieval system