KEGG   Xenopus laevis (African clawed frog): 108695979Help
Entry
108695979         CDS       T01010                                 

Definition
(RefSeq) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108695979
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108695979
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108695979
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108695979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7L
AA seq 258 aa AA seqDB search
MFLHHHHQLLLLISTMKFLLLCVLLGAAAAFDDDKIIGGATCAKNSVPYIVSLNSGYHFC
GGSLISNQWVVSAAHCYKASIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDI
MLIKLSSPASLNAAVNTVPLPSGCSAAGTSCLISGWGNTLSNGSNYPDLLQCLNAPILTD
AQCNSAYPGEITANMICVGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAMRNYPGV
YTKVCNYNSWIQSTIAAN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccaccatcaccatcaacttctgctactgatctccaccatgaagtttcttctg
ctgtgtgtcctgctgggagcggctgctgcctttgatgatgacaagatcataggaggcgcc
acctgcgccaagaactctgtcccctacattgtctccctgaactctgggtaccatttctgt
ggggggtccctgatctctaaccagtgggttgtgtctgctgctcactgctacaaagcgagc
attcaggtcagactgggggaacacaacatcgctctgagtgagggaaccgagcagtttatc
agctcctcaaaggtcattagacattctggctacaactcttggaccttggacaatgacatt
atgctgatcaagctctcctctcctgcctccctcaatgccgctgtcaataccgtgccactg
ccctccggttgttctgccgctggtaccagctgcttgatctctggctggggcaacactctc
agcaatggcagcaattatcctgacctcctgcagtgcctgaatgcccccatcctgactgat
gcccagtgtaacagtgcctacccaggggagatcaccgctaacatgatctgtgttggcttc
atggaaggtggcaaggattcctgccagggtgactccggtggccccgtggtgtgtaatggg
caactgcaaggtgtggtgtcctggggctatggctgtgccatgaggaactatcctggtgtc
tacaccaaggtctgcaactacaactcctggatccagagcaccattgctgccaactaa

DBGET integrated database retrieval system