KEGG   Xenopus laevis (African clawed frog): 108696758Help
Entry
108696758         CDS       T01010                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108696758
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108696758
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108696758
Glycosyltransferases [BR:xla01003]
 Polysaccharide
  Storage polysaccharide
   108696758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7L
AA seq 733 aa AA seqDB search
MPLARSLSVTSLTGLEDWDDDLDLENSILFEVAWEVANKVGGIYTVIQTKAKITTDEWGE
NYFLIGPYFENNVRTQVELIEPPNPAIKRALDSMNSKGCKVYFGRWLIEGSPYVILIDIA
ATAWNLDQWKTELWDSCAIGIPWYDREANDAVLFGFLTAWFLGEFAAQSEEKPYIIAQFH
EWLSGIGLCLCRVRKLPVATIFTTHATLLGRYLCAGSVDFYNKLQSFNVDKEAGDRQIYH
RYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KGRIQEFIRGHFYGHLDFNLDKSLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSDT
TIVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTIKEKFGKKLYESLLVGNLPDMNKML
DKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPTAYGIYILDRRFRSVDDSCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKY
LGRYYMYARHMALAKAFPDNFTYEPHEPTAAQGFRYPRPASVPPSPSLSRHSSPHHSETE
DDERYDEEEEAEKDRQNIKQPPVTSVGSIPEWHRRSKKGSIDATNSSNNSTPTNPSSPSD
LSSPTSSLIEERN
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagctcgcagcctgtccgtcacctccctcaccggcctggaggactgggatgat
gacctagatctggaaaactccatcctgtttgaggtagcctgggaagtggccaacaaagtg
gggggtatttatacagttatccagacaaaggcaaagatcaccacagacgaatggggtgaa
aactactttctgatcggtccctactttgaaaataacgtgcgcactcaagtggagctgatt
gagccacccaatcctgccataaaacgtgccctggactccatgaactcaaagggatgcaag
gtctactttgggcgctggctgatagaaggaagtccatacgttatcctgattgacattgca
gccacagcttggaaccttgaccaatggaagacagaactctgggacagctgcgccattgga
attccatggtacgacagggaagctaacgatgccgtcctgtttgggtttctcacagcctgg
tttcttggagagttcgcagcccaaagtgaggagaagccctatatcattgctcagttccac
gagtggctttctggcataggcctgtgtttatgccgggtacggaagctccccgtggctacc
atattcactacacacgccaccctcttggggagatacctgtgtgctggaagtgtagacttt
tacaacaagttgcagtcgttcaatgtagataaagaagctggagaccggcagatctatcac
cgatactgtatggagcgagctgctgtgcaatgcagtcacgtctttactactgtatctcag
atcactgccatagaagctgaacatctgttgaaacgaaagcctgatatagtgacaccaaac
ggtttgaatgtaaagaagttctcggccatgcacgagtttcagaacctacatgcgcagagc
aagggccgcatacaggagtttatcagggggcatttttacggacacctggatttcaatttg
gacaagagtctgtttttcttcattgctggccgctacgaattctcgaacaaaggagcagat
gtatttttggaggctttggcgaggctcaactaccttctgagggttaatcacagtgacaca
accattgttgcctttttcatcatgccggctcgaaccaacaacttcaatgtggaaacacta
aagggtcaagcagtacgaaaacagctgtgggatacagccaacacaattaaggagaagttt
ggaaagaaactgtacgagtcattactagtagggaatttgccagatatgaataagatgctg
gataaggaggactttacaatgctgaagagagccatatttgccacgcagagacactccttc
cctcctatatgtacccataacatgcttgatgactctacagacgccatcctgaacactatc
cggaggatcggcctgtttaacagcagctctgaccgtgtgaaggttattttccatccagaa
ttcctttcctcaactagcccacttttacccatggattatgaggaatttgtacgtggttgt
cacttgggagtcttcccctcttactatgaaccttgggggtacacaccagctgaatgtact
gtcatgggaattcccagtgtttccaccaacctctctggatttggatgttttatggaggag
cacattgcagaccccactgcttatggtatttatatcttagaccgacgattccgctcggtg
gacgactcctgcacccaactcacatccttcctctacagcttctctcaacaaacccggcgg
cagcgcattattcagaggaaccgcacagaacgtctctctgacttgttggattggaagtac
ctggggaggtattatatgtacgctcgacacatggctctcgcaaaggccttccctgacaac
ttcacgtatgagcctcatgaaccaacagctgctcagggattccgttacccacgcccagca
tctgtacctccgtctccttccctgtcccgacactccagcccgcaccacagtgaaacggaa
gacgacgaacgatatgacgaagaggaagaagctgagaaagaccgtcagaacatcaagcag
ccgcccgtgacctccgtgggctcgatccccgagtggcaccgacgctccaagaaaggttcc
attgatgccaccaattccagtaacaacagcacacccacgaatccaagcagcccaagcgac
ctcagcagccccaccagctcactcattgaggagcggaactaa

DBGET integrated database retrieval system