KEGG   Xenopus laevis (African clawed frog): 108701359Help
Entry
108701359         CDS       T01010                                 

Gene name
b3galt1.L
Definition
(RefSeq) Beta-1,3-galactosyltransferase 1 L homeolog
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00601  Glycosphingolipid biosynthesis - lacto and neolacto series
xla01100  Metabolic pathways
Module
xla_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108701359 (b3galt1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     108701359 (b3galt1.L)
Glycosyltransferases [BR:xla01003]
 Glycan extension
  Type 1 chain
   108701359 (b3galt1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 108701359
NCBI-ProteinID: XP_018091366
Xenbase: XB-GENE-17339331
UniProt: A0A1L8EW96
LinkDB All DBs
Position
9_10L
AA seq 325 aa AA seqDB search
MASKVSCLYILTVVCWASALWYLSVTRPTSSYTAHRVGNIAIIQKNVTFGNIRTRPINPH
SFEFVINEPEKCGNDSPFLVILISTTHKEFDARQAIRETWGNESNFKGIKIVTLFLLGKN
SDPVLNQMVEQESQIFHDIVVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIF
VNMDNLIYKLLKPTTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPESNYPPFCSGTGY
IYSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI
TVHQIGPEEMHRIWNDMSSKKHLRC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcgtgtttatatatattgacagttgtgtgctgggcaagtgccctg
tggtatctaagtgttactcgcccaacttcttcatacacagcccacagagtaggcaatata
gccattattcaaaaaaatgttacatttggtaacataagaactcgacccataaacccgcat
tcttttgaatttgttataaatgagccggaaaaatgtggaaacgacagtcctttcctggta
attcttataagcacaacccataaggagtttgatgcaagacaagcaattcgagaaacctgg
ggaaatgaaagcaactttaaaggaattaaaattgtcacgctttttcttttaggcaaaaac
tcagatccagtcttaaatcagatggttgagcaagaaagtcagatctttcatgatattgtt
gtagaagacttcatagactcctaccataacctaactctcaaaacactgatgggtatgaga
tgggtagccaccttctgctcaaaagcaaaatatgtcatgaaaacagacagtgatattttt
gtaaatatggataacctgatttataagttactgaaacccaccacaaagcctcggagaagg
tactttactggatatgttataaacggaggacctataagggatgttcggagtaagtggtac
atgcctagagacttatacccagagagcaattaccctcctttctgttcaggaactggctat
atttattctgctgatgttgcggaactcatttataaaacttctcttcataccagacttttg
catcttgaagatgtctatgtagggctttgtttacggaagcttggtattcacccatttcaa
aacagtggctttaatcactggaaaatggcctacagcttatgtagataccgacgggtaatc
acagtgcatcaaataggtcctgaagaaatgcacagaatttggaatgacatgtcaagcaag
aagcatcttcgatgttaa

DBGET integrated database retrieval system