KEGG   Xenopus laevis (African clawed frog): 108701795Help
Entry
108701795         CDS       T01010                                 

Gene name
tgm6.L
Definition
(RefSeq) transglutaminase 6 L homeolog
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108701795 (tgm6.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108701795
NCBI-ProteinID: XP_018092305
Xenbase: XB-GENE-17333818
LinkDB All DBs
Position
9_10L
AA seq 708 aa AA seqDB search
MLLKEPANDPQVIACDWYYTVNEKAHHTDVYESDDLVLRRGQPFKLTLILNRPLQPEENI
FFTIETGPSPSETSKTKVVFPLFRAEIQQSWGAILTGLKSTSITVTINSHPDAVIGRYFL
SVAILGRGSSKQPPQSIGAFNLLFNPWLQGDAVFMAEEDQRQEYVINEQGVIFQGSDEDI
TSINWEYNQFEKDILDICLIILDRSSSYKRDPALDVSKRNDPLYVCRVLSAMLNSKDDDG
VLEENWSDDYKNGVSPFSWNGSINILKSWYYSKFKPVKYGQCWVYAGVLCTVLRSLGIPT
RVVTHFNSGQDKNGNLFIDLQYKSQGSRQNDQEDQLWNFHVWNEAYFKRRDVGKLYNGWQ
VIDSTPLKRSDGMYQCGPAPLTAIKEGDINLNYDVKYMFASVNADVACWIHYINGTKKQV
SNNRKETGKFISTKAVGSNDRMDVTHNYKYATGSEKEIQIFEKALKLTIAPFMGRTREKP
QGEKILSGRCTVDQTSTFGQDINFILNLKNLTTKSIKVSVYINASAILYTGRHRHTIWTD
EKSLILDPDLEKRFSVPITYGQYGKLLIDNGVIRMTALCVVEGTEERILVERNVSLVMPP
VSMTLPEKATINQEFNANIVIANPLSETMNSCILWVEGYGLTDKILQKEVPSLKPGQSSD
NNFVITPTKTGVRTLLVNFSCDKIQSMKGSSKILITDSQEVFGSPVPT
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcaaagagccagcaaacgacccgcaggtcatcgcctgtgactggtattataca
gtcaatgaaaaggcccatcatacagatgtctatgagagtgatgatctggtgctcaggaga
ggacaacctttcaagctcacactcatcctcaacagacctctacaaccagaggaaaatatt
ttttttaccattgaaacaggtccatccccatctgagacttcgaaaacaaaagttgtgttc
ccattgtttagggccgaaattcaacaatcgtggggagccattttgacaggcctaaagtca
acgtcaataacagtgaccatcaacagtcatccggatgctgtgattgggcgctattttcta
agcgtagccattctaggccggggatcaagcaagcaacctccacagtcaattggggcattt
aatcttctcttcaatccatggttacaaggggatgcggtgttcatggctgaagaggatcag
cgacaggaatacgttattaatgaacagggagttatcttccaaggaagtgatgaagacatt
acatctattaactgggaatataatcagtttgaaaaagacatacttgatatttgcttgatt
atacttgaccgaagctcaagctataaaagagaccctgcgctggatgtgtcaaagaggaat
gacccactctacgtgtgcagagttctcagtgctatgttgaatagtaaggatgacgatggt
gtcctggaggagaactggagtgatgactataagaacggggtgagcccattcagttggaat
ggcagtatcaacattctgaaaagctggtattacagtaaattcaaacctgtaaagtatggt
cagtgctgggtatatgcaggagtgctttgcacagtactacgaagcttggggattccaacc
agggtcgtcacacacttcaactcaggccaagacaagaatgggaatctgttcattgattta
caatacaaaagccaaggaagtagacaaaatgatcaagaggaccagctctggaatttccat
gtttggaatgaggcctatttcaaacgcagagatgtagggaaattgtataatgggtggcag
gtgatagattcaactccccttaaaaggagcgacggaatgtatcaatgtggcccagctcct
ctaactgccatcaaagaaggggatatcaatctcaactatgatgtaaaatacatgtttgca
tcagtcaatgccgatgttgcctgctggatccactacattaatgggacaaagaaacaggtt
tccaacaaccgcaaagagactggcaaatttatcagtacaaaggctgtagggagtaacgac
agaatggacgtcacacataattacaaatatgccacaggatctgaaaaggaaatacaaatc
tttgaaaaggctctgaaactgaccatagctcccttcatgggaagaaccagggaaaagcca
caaggggaaaagatattatctggacgatgtacagtggaccaaacctctacctttggccag
gatattaattttatactaaaccttaaaaacctgaccactaagagtattaaagtaagtgtg
tacataaacgcttcagcaattctctacactggaagacacagacatacgatctggacagat
gaaaagtctctcatcctagatcctgatttagaaaaacgcttttcagttccaatcacttat
gggcagtatgggaagctcctgatcgacaatggtgtgatacgcatgaccgccctatgtgtg
gtagaggggacagaagaaaggattttggtggaaaggaatgtctcattggttatgccccca
gttagcatgacgcttcctgaaaaggccaccataaaccaagaattcaatgcaaatattgtg
attgccaaccctttgtccgaaaccatgaactcctgcattttatgggttgaaggatatggt
cttactgacaaaatactccagaaagaggtcccatcactgaaacctggacaatcaagtgat
aataattttgtgatcacccctacaaagacaggcgttcggacattgcttgtgaacttttcc
tgcgacaagatacaaagcatgaaaggatctagtaaaatcctcataactgacagtcaggaa
gtctttggcagtcccgtacctacttga

DBGET integrated database retrieval system