KEGG   Xenopus laevis (African clawed frog): 108702207Help
Entry
108702207         CDS       T01010                                 

Gene name
tgm5.S
Definition
(RefSeq) transglutaminase 5 S homeolog
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108702207 (tgm5.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
9_10S
AA seq 731 aa AA seqDB search
MTAVPEIAFSDFQIKRNNTAHHTNETGDSRLFVRRGQPFFITVHFKARGFQPGQDNVIFL
VETGPWPDESAGTKAIFPLSKALNKTMWSAALENNGSNSTVLIIHSPHTAIIGQYQLKMQ
ISSGTKTTNYNLGTFMLLFNPWCADDDVFMANETDRQEYIMNDYGFVYQGNHNWISPCPW
NFGQFEDDIVDISLKILDKNLNYIQDAFKDLACRNNPVYISRVICAMINSNDDNGVLQGN
WSGDYTGGVSPSAWNGSVLILRQWFKSDCQPVKYGQCWVFAAIMCTVMRSLGIPTRVVTN
FDSAHDTDQNLLIDEYYDLTGNKLNKEKKDSIWNFHVWCECWMARRDLPPGYGGWQVLDP
TPQEASNGIFVCGPASVKAIREGEVHLNYDAPFVFAMVNADCVSSVVTRKGNEKSNCDPH
LVGNKISTKRAGSDEREDVTHQYKYEEGTAEERKVFEKALSRLHKGGPMIPNSNRNENEN
INRANETSANGITPSPGGSSGYTPRNQDPNLNRPLREALLLLKFKLTESPQLGDTISLVL
LAGNLISTAKTLKLSLSAQALKHDGKPAQQFWKDSVYVELRPHEEKILLFKIPYAKYGPF
LEDNNLIRFIAIGEQSITWEKVLVEKDVNLALPTVAINFLGPAAVDRPCKVEISFSNPIN
EEIRDCQVLVQGSGLLKKQVKLNMGTMKPGQKAVVSFEVVPCKVGYKQLQVNISSNRFNG
LKGFKSVVVKP
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagtcccagagattgctttctccgattttcaaattaaaagaaataatacagcc
caccatacgaatgaaacgggagacagtcgtctctttgttagaagaggacaaccattcttt
attaccgttcactttaaagcaaggggctttcaaccaggacaggacaatgtcatcttcctt
gtggaaacaggtccttggcctgatgaatctgctgggacaaaggccatattccctttatca
aaggctttaaacaaaacaatgtggagtgctgcactggagaacaatggatctaactctaca
gtcctcattatacattcaccccataccgctattattggacaatatcaactaaagatgcaa
attagcagcgggaccaaaaccaccaactacaatctggggacatttatgttactcttcaac
ccttggtgtgcagatgatgacgtattcatggcaaatgaaaccgacaggcaggaatatatc
atgaacgactacggatttgtttatcaaggaaaccataactggatatccccctgcccttgg
aattttggacagtttgaggatgacattgtggatatcagtctaaagattctagacaagaat
ttaaactacattcaagatgcttttaaagatttagcatgtaggaataaccctgtatatatc
agcagagtaatctgtgctatgatcaacagtaatgatgacaatggggtgttacaaggtaac
tggtctggggactatacaggtggagtctccccgtctgcctggaatgggagtgtactcatt
ttaagacaatggtttaaaagtgactgtcagccggtgaaatatggacagtgctgggtgttt
gctgctatcatgtgcacagtgatgagaagtttaggaatcccaacccgagttgtaacaaat
tttgactcggctcatgacacagaccagaatctgctgattgatgaatactatgatttaact
ggaaataaactgaataaagaaaaaaaagacagcatttggaacttccatgtgtggtgtgaa
tgttggatggcacggagagacttacctccaggatatggagggtggcaggtccttgaccca
actccacaggaggcaagcaatgggatctttgtctgtggtcctgcttcagttaaagctatc
cgagagggagaggtacacctcaactatgatgctccgtttgtgtttgcaatggtgaatgca
gactgtgtgtcctcggtagtcaccagaaaaggaaatgaaaagagcaactgtgacccacat
ttagttggcaacaagatcagcacaaaacgtgccggcagtgatgagcgtgaagatgtgacc
catcaatataagtatgaagaaggaacagctgaagaaagaaaggtgtttgagaaggccctg
agccgactacacaaaggaggtccaatgattccaaacagtaaccgcaatgagaatgagaat
ataaacagagctaatgaaacatcagccaatggtatcactccttcccctggtggatcctct
ggatacacacctcgaaatcaagatccaaaccttaatcgccccctgagagaggctttattg
ttgctgaagtttaaattaactgaatctccccagcttggagataccatcagtttggtgttg
ctggctggaaatctgatctccactgccaaaactttaaagctgagcttgagtgcccaagct
ttgaaacatgacggaaaaccagctcaacagttctggaaagactcagtgtatgtagaactg
cgtccacatgaagagaaaattcttttattcaaaatcccttatgcaaagtatggacccttc
ttagaagacaataatttgatacgatttattgcaattggagaacagagcattacctgggag
aaggttttagtggaaaaagatgttaatttggctttacctacagtagctattaatttcctt
ggacctgctgctgtggacagaccatgtaaagtagagatctccttttccaaccccattaat
gaggagatacgtgactgtcaggtcctagttcagggcagtggtttgctgaaaaaacaagtg
aaattaaacatgggcaccatgaagccaggacagaaggcagttgtgtcgtttgaagttgtt
ccgtgcaaagtgggttacaaacagctacaggtgaacatcagcagcaaccgcttcaatgga
ctcaaaggttttaagagtgtggttgttaaaccttaa

DBGET integrated database retrieval system