KEGG   Xenopus laevis (African clawed frog): 108704915Help
Entry
108704915         CDS       T01010                                 

Gene name
tgm1.S
Definition
(RefSeq) transglutaminase 1 S homeolog
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108704915 (tgm1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
1S
AA seq 765 aa AA seqDB search
MALREERKKSFWENLCSCCCGDRSEYEPDNPMRPVVRPDGGRDIDIPASPSSRPSPASPS
PASPSPASPSPASPSPASPSPTPSPSIGGALQVQSVDLLKQRGGETRRAHHTDEFEYDEL
IVRRGQPFKICVTFQRAFIPKSDQICVVLQMANAQPVTLSQVNEFEQSGWGCQVAEVSGS
KAFVWLNTSAQAPVGLYQMNVKTNSGGGANTNLRVYILFNAWCRMDSVFMDNEAWRCEYV
LNEIGRIYYGTEHQIGERSWNYGQFDKGILDACFYLLDRGRIGPGSRGDPISVTRVISAM
VNSMDDNGVIAGSWAESYADGVNPVAWVGSVDILLRFHQTGNPVKYGQCWVFGGVTTTVL
RCLGIPGRTITNFASAHDTDGNLTFDVYFDENMKPIEEKNGDSVWNYHVWNDCWMTRPDL
PAGYSGWQAIDATPQETSNGIYCCGPCPVLAIKNGQTNIKYDAPFIFAEVNSDKVSYQRM
PNGQFKRVLVEERAVGHCISTKAVGSFAREDITYLYKYPEGSAEERNSVHTAARISNKPL
AAVDASANAVDTSDVSMTIESQDGVIRGSDINVRVTLKNNSNSRRCVSLSMAVGVMFYNG
VCKESFKNESREVLLNPREGKAVGMLISYAEYSKHLVGQGAMMLTVSGIVKETGQKLAKQ
HTFRTRTPDLVIKVRGAARVGQQIVAEVIFTNPLNTTLHNAVFHVEGPGLQRPKVIQYGN
IGPLQTVSITERFTPRRPGPRQFIASLESTELSQVHGVTEVVVQA
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgcgaggagaggaaaaagtctttctgggagaacctttgctcatgttgctgc
ggagacagaagcgaatatgagccagacaatcctatgagaccagtagtgagacctgatgga
gggagggacatagacattcctgcttctccttcatctagaccttcacctgcatcaccttca
cctgcatcaccttcacctgcatcaccttcacctgcatcaccttcacctgcatcaccttca
cctacaccttccccatctatagggggagcactgcaggttcaaagtgtggatttgttgaag
caacgtggaggagaaacacgtagagctcaccatactgatgaatttgaatatgatgagctg
attgtgcgtagaggtcagcccttcaaaatttgtgttactttccagagagcattcatcccc
aagagtgatcagatctgtgttgtgctgcaaatggcaaatgctcagccagtcaccctttca
caagttaatgaatttgagcaaagtggttggggatgtcaagtcgctgaggtcagtggttcc
aaagcatttgtatggttgaacacatcagctcaggctccagtgggactataccaaatgaat
gtgaagactaacagcggtggaggagcaaacaccaatctcagggtctatatcctcttcaat
gcctggtgccgaatggattcagtctttatggataatgaagcatggcgttgtgaatacgtg
cttaatgagattggcaggatatattatggcactgaacatcagattggagaacgatcctgg
aactatggacagtttgataaaggaatccttgatgcctgcttctatctgttagaccgtggt
cgtataggacctggttcacgaggagatcccataagtgtcacccgagtcatatctgccatg
gtaaattcaatggatgacaatggagtgattgcaggaagttgggctgaatcttatgcagat
ggagtgaatcccgttgcctgggttggaagtgtagacattttactccgatttcaccagact
ggaaacccagttaaatatggacagtgctgggtgtttggtggtgtcacaactacagtacta
cgatgccttggaattcctggacgaaccataaccaattttgcatctgcgcatgatactgat
ggaaacctcacatttgatgtttattttgatgagaacatgaagcccattgaagaaaagaac
ggtgactcggtttggaattaccacgtgtggaatgattgctggatgacacgcccagaccta
cctgcaggatatagtggttggcaggcgattgatgctacccctcaggagaccagcaatggt
atttactgctgtggcccttgtcctgtacttgccattaaaaatggacagactaatataaaa
tatgatgcaccattcatctttgctgaggtaaacagcgacaaggtcagctaccagcgaatg
ccaaatggtcaatttaagcgggttcttgtggaggagagagcagttggccactgcatcagc
accaaggcagttggctcttttgcacgggaggacatcacttacctgtataagtacccagaa
ggatcagcagaagagcgtaactcagtccacactgctgcgcgcatttcaaacaaaccactg
gcagctgtagatgcatctgcgaatgctgtagatacaagtgacgtgtcgatgactattgag
tcacaggatggtgttatcaggggaagtgacatcaatgtccgggtaacgctgaaaaataac
agcaacagtcgacgctgtgtgtctttgtcgatggccgttggtgtcatgttctacaatgga
gtttgcaaagaatcattcaaaaatgagtccagagaggtgttattgaatccaagagaagga
aaggcagttgggatgctgattagttacgcagagtacagtaagcatttagtgggtcagggc
gccatgatgctcactgtgtctggaatagtaaaagagacgggtcagaaacttgccaaacag
cacacatttagaacaaggactccagatctggtcatcaaggttcggggagctgctagagtt
ggccaacaaatagtggcagaagttatattcacaaacccactgaatacaactctgcacaac
gctgttttccatgtggaagggccgggcctgcagaggccaaaggttatacaatacggtaac
attgggcccctccagactgtatccatcacagagcgattcacacctagacgtcctggtcct
cgccagtttatagccagcttggagagtaccgaattgagccaagtacatggagtcacagaa
gtagttgtacaagcctga

DBGET integrated database retrieval system