KEGG   Xenopus laevis (African clawed frog): 108707197Help
Entry
108707197         CDS       T01010                                 

Gene name
aldh7a1.S
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1 S homeolog
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00053  Ascorbate and aldarate metabolism
xla00071  Fatty acid degradation
xla00260  Glycine, serine and threonine metabolism
xla00280  Valine, leucine and isoleucine degradation
xla00310  Lysine degradation
xla00330  Arginine and proline metabolism
xla00340  Histidine metabolism
xla00380  Tryptophan metabolism
xla00410  beta-Alanine metabolism
xla00561  Glycerolipid metabolism
xla00620  Pyruvate metabolism
xla01100  Metabolic pathways
Module
xla_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
xla_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108707197 (aldh7a1.S)
   00053 Ascorbate and aldarate metabolism
    108707197 (aldh7a1.S)
   00620 Pyruvate metabolism
    108707197 (aldh7a1.S)
  Lipid metabolism
   00071 Fatty acid degradation
    108707197 (aldh7a1.S)
   00561 Glycerolipid metabolism
    108707197 (aldh7a1.S)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    108707197 (aldh7a1.S)
   00280 Valine, leucine and isoleucine degradation
    108707197 (aldh7a1.S)
   00310 Lysine degradation
    108707197 (aldh7a1.S)
   00330 Arginine and proline metabolism
    108707197 (aldh7a1.S)
   00340 Histidine metabolism
    108707197 (aldh7a1.S)
   00380 Tryptophan metabolism
    108707197 (aldh7a1.S)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108707197 (aldh7a1.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108707197 (aldh7a1.S)
    1.2.1.8  betaine-aldehyde dehydrogenase
     108707197 (aldh7a1.S)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     108707197 (aldh7a1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 108707197
NCBI-ProteinID: XP_018099766
Xenbase: XB-GENE-17339448
UniProt: A0A1L8HR02
LinkDB All DBs
Position
1S
AA seq 540 aa AA seqDB search
MLQQLAFPLYRHFLLKRKIFASCCRQAAAMSSLLINQPEYSWLKDLGLKEENEGVYNGTW
GGKGEVVTSYSPASNAPIARVKQATLEEYNETVNKAKEAWKIWTDIPAPKRGEIVRQIGD
ALRKKIKLLGHLESLEMGKILVEGVGEVQEYVDICDYAVGLSRIIGGPILPSERPGHALI
EQWNPVGLVGIITAFNFPVAVYGWNNALALICGNVCLWKGAPTTSLTSVAVTKIVAQVLE
DNNLPGAICSLTCGGADIGNAIAKDERVDLVSFTGSTNVGKQVALKVQERFGRKLLELGG
NNAIIVFEDADLSLVTPSVLFAAVGTAGQRCTTARRLFLHESIHDEIVEKLSKAYAQVRI
GDPCEPDILCGPLHTKQAVEMYLSAIEQAKCEGGTVVCGGKVIDRPGNFVEPTIMTGLAH
DAAIVHKETFAPILYVMKFKTEEEAFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCG
LVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKYYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcagctagccttcccattatatagacattttctgctgaaaaggaaaatcttt
gcttcctgttgcagacaggcagctgctatgtcctctctgttaattaaccaacccgagtat
tcatggctgaaagatctgggcttgaaggaggagaatgaaggagtttacaatggtacatgg
ggaggaaaaggagaggttgtgacatcctacagtcctgcgagcaatgcgccaatagctaga
gttaaacaggccacgctagaggaatacaatgaaactgttaataaggctaaagaagcatgg
aagatatggacagatatcccagcaccaaagcgtggggagattgtgagacaaattggggat
gcactgaggaaaaagataaaacttcttggacacctggaatccttagagatgggaaagata
ttagttgaaggagttggagaagtgcaagaatatgtagatatctgtgattatgctgtaggt
ctttctcgtataattggaggacccatactgccttcagaaagacctgggcatgctttgatt
gaacagtggaatccagtgggtttggtgggtataattaccgccttcaattttcctgttgct
gtgtatggctggaacaacgcacttgctctaatttgtggaaatgtctgtttatggaaagga
gctcctaccacatcccttactagtgttgctgtgacaaaaattgttgcacaagtattagaa
gataacaatttgcccggtgctatctgttccttgacgtgtggtggtgcagacattggcaac
gctatagcaaaagatgaaagagtagatctggtgtcattcactgggagcacaaatgttgga
aagcaggtggcacttaaagttcaagaaaggtttggacgcaagttactggaactgggtgga
aacaatgccattatagtgtttgaggatgccgatcttagtctagtaactccctctgttcta
tttgcggctgtgggcacagcaggccagaggtgcactactgccaggaggctgtttttacat
gaaagcattcatgatgaaattgtggagaagctatctaaagcttatgcacaagtgcgaatc
ggagatccctgtgaacctgacatactttgtggtccgctacacactaagcaggcagtggaa
atgtatctgtctgctattgagcaagcaaaatgtgaaggaggtacagttgtgtgtggtggc
aaggttatagatcggccagggaattttgttgagccaactatcatgactggactagctcat
gacgctgctattgttcacaaagagacctttgcaccaatactgtacgtgatgaaatttaag
actgaagaagaggctttcgcatggaacaatgaggtgaaacagggcctttcaagcagcatc
tttactaaggatctgggaaggatttttcgctggcttgggccaaagggatcagattgtggc
ttggtgaatgtaaacattcctacgagtggagctgaaattggaggagcttttggaggtgaa
aaacacaccggaggcggcagagaatctggcagtgattcttggaaatattatatgagaagg
tctacctgtaccatcaattacagcaaggacctgcctctggctcagggtataaaattccag
tga

DBGET integrated database retrieval system