KEGG   Xenopus laevis (African clawed frog): 108707883Help
Entry
108707883         CDS       T01010                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] B
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    108707883
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108707883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2L
AA seq 151 aa AA seqDB search
MVKAVCVLAGSGDVKGVVHFEQQDEGAVSVEGKIEGLTDGLHGFHIHVFGDNTNGCMSAG
SHFNPENKNHGAPGDTDRHVGDLGNVTAEGGVAQFKITDSLISLKGPNSIIGRTAVVHEK
ADDLGKGGNDESLKTGNAGGRLACGVIGYSP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcagtgtgtgtgctggcgggaagcggcgatgtgaagggagtggtgcacttc
gagcaacaggatgaaggagcagtgagtgtggaagggaagatcgagggactgactgacgga
ctgcacggcttccatattcatgtgtttggggacaacactaatggctgcatgagcgctgga
tctcatttcaaccccgagaacaagaatcacggagccccgggagatacagacaggcacgtg
ggagacctgggcaatgtgacggctgaaggtggagtcgctcagttcaaaatcacagattct
ctgatctccctgaaaggcccaaactccatcattggccgcactgctgtggtccatgagaag
gcagacgacttgggcaaaggtggaaatgatgagagtctgaaaacgggcaatgctgggggt
cgtctggcttgtggtgtgatcggttatagtccgtga

DBGET integrated database retrieval system