KEGG   Xenopus laevis (African clawed frog): 108709883Help
Entry
108709883         CDS       T01010                                 

Gene name
hdac7.S, hdac7a
Definition
(RefSeq) histone deacetylase 7 S homeolog
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108709883 (hdac7.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108709883 (hdac7.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 108709883
NCBI-ProteinID: XP_018105601
Xenbase: XB-GENE-6486680
LinkDB All DBs
Position
2S
AA seq 973 aa AA seqDB search
MPGLHQMLNTIYEADSASSTDGIRRGEPGLRFGHKSGATGAVDLSAPVSTILTQANPMAF
QIVHRLGHHAEPTLLPIKQSKQQLFSNLSQHQPVEHQLRLGTEPACRNAELVRQEPSLRQ
LVNKEKGKTNAMASPAVKQKILEMIQKKKFAPDRKNIANHSTAVPYRSPEIVDKEAPPPP
SIMTNFASQVSNNSCNPSEHFPLRRTASEPNLKWPCRPKKSGERRKNPLTRKESAPPAVR
RRPPETQDSSPSSSSTPVSGCSSPNDSIPAENGSLSSIPGAASEGEVSRRAVPGVVHRTS
YLTPHPIFMAPSIEGHDGTSPLATRLQPLIILEPSGAHTPLVAVQGLGSVQFAHAFISSD
HHKPLSRTRSEPLPQQQLLYQQHYSIFPEHLKQQRQLSKQRSQKTSERPRLSQIPSEEMD
ESSSPTADCPNDLGGNPTRVRSESQRAGQHETLSSSQQAIQQQHSFHPQAYFYESSLHRP
GKRPLDTLMIPMMPGGHRPLSRAKSSPASASLPAQEPSAKAMSIPMPEQATKPRFTTGIV
YDSVMLKHQCTCGDNSNHPEHAGRIQSIWSRLQERGLRNHCECIRGRKATLEELQSVHTE
THVLLYGTNPLNRLKLDNRKLAGILSQRMFVMLPCGGLGVDSDTIWNELHSSNAARWAAG
SVIDLAFKVASRELKNGFALVRPPGHHADPSTAMGFCFFNSVAIAAKQLQLRHDVRKILI
VDWDVHHGNGTQRVFYTDPNVLYISLHRHDDGNFFPGSGAADEVGAGNGEGFNVNVAWTG
GLEPPMGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAAEGHPAPLGGYKVTAKCFGQM
TQQLMNLAEGRVVLALEGGHDLTSICDASEACISALLGNELDPLPEETLRQRPNQNAVRS
LETVIHVQSKYWTSVKQFASKVQYTLLEAQKHDRDEVDTVTALASLSVGKGSITVAGNRP
QEEPMEEDEPMSL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgcctggattacatcaaatgctaaacaccatttacgaggctgattccgcttcttccaca
gatggcatccgacggggcgagccgggactgaggtttggccacaagagcggtgctactgga
gcagtggatttgagtgccccagtcagcacaatcttgactcaagccaatcccatggcattc
cagattgtccatcgtcttggtcatcacgctgagccaacactcctgcccatcaagcagtcc
aagcaacagctcttctcaaatctctcccagcaccagccagtggaacaccaattgcggctg
ggtacggagccagcctgtcggaatgcagagcttgtgcgacaagaaccaagtttacggcag
cttgtgaacaaagaaaaaggaaaaacaaatgccatggccagccctgcagtgaagcagaag
attttagagatgatccagaaaaagaaatttgcgccggatcgaaaaaatattgcgaatcac
agcacagcggtgccctacaggtctcctgaaattgttgataaagaagcacccccaccgcca
tcaatcatgactaactttgcttctcaggtgtctaacaactcttgtaacccctctgagcac
ttccccctacgcaggacagcctcagagccaaaccttaaatggccctgcagacccaagaag
tctggagagcggaggaaaaaccccctaacccgaaaggaaagtgctccacctgctgtcaga
aggagacccccagagacacaggactcctcaccaagcagtagcagcactccggtgtcagga
tgcagttctccaaatgatagtatccctgcggaaaacggaagcctttcctccattcctgga
gctgcctctgagggagaagtgagtcgaagggcagtgccaggtgtagttcatcgcacctca
tatctaacaccgcacccaatcttcatggcgcccagcatagagggtcatgatggcacctcc
ccccttgccacccgcttacagccgctcatcattctggaaccgtcaggtgcacacactcct
cttgtagcagttcaaggcctgggctctgttcagtttgcacatgctttcataagctccgat
caccataagcctttgagccggacccgctcggaacctcttcctcaacagcagcttctgtat
cagcagcattactccatatttcctgaacatttgaagcagcagcgccagttaagtaagcag
cgctcccagaaaaccagtgaaaggccacgcttatcccagatcccatcagaggaaatggat
gagagttctagccccacagctgactgtcccaatgatctgggaggaaatcctacacgagtg
agatcagaatcacagcgagctgggcaacatgagactctcagtagcagccaacaagcaatt
cagcaacagcactccttccatccgcaggcctatttttatgaatccagcctccacagacct
gggaaacggccattggatacgctaatgatccccatgatgccaggtgggcatcgcccactt
tcccgagcaaagtcctctccagcctctgcatctctgccagctcaagagccttctgccaaa
gcaatgtcaattccaatgccagaacaagctaccaagcctcgcttcactacaggaattgtg
tatgactcagtaatgctgaaacatcagtgtacttgtggagacaacagcaatcacccagag
catgctgggagaatccaaagcatctggtcccgcttacaagagagaggcttacgcaatcat
tgtgaatgtatccgggggaggaaggctacattagaggagctgcagtctgttcacacagaa
acccatgttctactctatggaaccaatcccctcaacagactcaaactggataaccgcaag
cttgcaggaattctctcacaaaggatgtttgtaatgctgccgtgcggaggacttggggtg
gacagtgataccatctggaatgaactccactcctccaatgcagcacgctgggcagcaggc
agtgtcattgatctggcatttaaagttgccagccgagagctgaagaatggctttgcgtta
gtgagacccccaggacatcatgcagacccctcaacggcaatggggttctgcttctttaac
tcagtggccattgcagcaaaacaactgcaactaagacacgatgtgagaaagatcctcatt
gtggactgggatgtacaccacggaaacggaacacaacgagtattttacacggaccctaac
gtgctgtatatctctttgcatcgacatgatgatggcaactttttcccgggcagtggagca
gctgatgaggttggtgctgggaatggtgaaggtttcaatgtcaatgttgcatggacaggc
ggtttggagcctccaatgggggatgtggaatacctcacagcttttcggacggtggtaatg
ccgattgcccatgagttctctccagatgtcgtcttggtttctgctgggtttgatgcggct
gaaggacacccagctcctcttggaggatataaagtcacagcaaaatgcttcgggcaaatg
acgcagcagctcatgaacttagcagaaggccgagtggtgcttgctctggagggaggtcat
gatctgacatctatatgtgatgcttcagaggcctgtatctcggccctgttgggaaatgag
ctggatcccctccctgaagagactttaaggcagaggcccaaccaaaatgctgtgcgttcg
ctggaaactgtcatacatgtccaaagtaaatactggacatcagtcaaacaatttgcctcc
aaggtgcaatatacccttctggaagcccagaaacatgatcgggacgaggtggacacagtg
acagctttagcctccttgtcagtggggaagggatccattacagtagctgggaacaggcct
caggaagagccaatggaggaagatgaacccatgagtttatga

DBGET integrated database retrieval system