KEGG   Xenopus laevis (African clawed frog): 108714508Help
Entry
108714508         CDS       T01010                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00590  Arachidonic acid metabolism
xla01100  Metabolic pathways
xla04370  VEGF signaling pathway
xla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    108714508
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    108714508
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    108714508
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108714508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 108714508
NCBI-ProteinID: XP_018114292
UniProt: A0A1L8GNN4
LinkDB All DBs
Position
4L
AA seq 604 aa AA seqDB search
MIVLPAAVFLSLLLFSQAASPCCSNPCQNQGVCMTVGFDRYECDCTRTGFYGENCTTPEF
LSWLRLKLKPTPNTVHYILTHFKGVWNIVNSISFLRDAIMRYVLTSRSHLIDSPPTYNSH
YAYKNWEAYANLSYYTRALPPVERDCPTPMGVKGLKELPSAKLVVEKFLMRRKFIPDPQG
TNVMFAFFAQHFTHQFFKTDMAKGAAFTKALGHGVDLNHVYGENLERQHKLRLMKGGKLK
YQMIDGEMYPPTVKSAGVDMMYPPHVPEHLQFAVGQEVFGLVPGLMMYSTIWLREHNRVC
DILAGEHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPQLLFNQKFQY
QNRIAAEFNTLYHWHPLLPDTFAINEKEYGYPQFLYNNSLILNHGLTQMVESFSRQSAGR
VAGGRNFPAAITRVAVASIEQSREMRYQSLNEYRKRFMLKPFESFEELTGEKEMSAEFEK
LYGDIDAMELYPGLLVEQPRPGAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGS
VGFDVVNSASLQNLICNNVRDCPYTAFHVLKSKPSGKDFINASSDSTLENVKPSLILKEH
ASEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtactacccgccgctgtgttcctctctctgctgctcttctcccaagcagcaagc
ccatgctgttcaaatccctgtcaaaaccaaggggtgtgcatgaccgttggcttcgaccgc
tatgaatgtgactgcacgagaactggcttctatggagaaaactgcaccacaccggaattc
ttatcgtggttgaggctgaagctgaagccaacccccaacaccgtgcactatatcttgact
cacttcaaaggagtatggaatatagtcaacagcatctccttcctgcgggacgccattatg
agatatgtcttaacatcacggtcgcacctgattgacagcccacccacctataacagccac
tatgcctataaaaactgggaggcatatgccaacctgtcctattatacccgtgccttgcct
cctgtggaacgtgactgccctaccccaatgggagttaaaggactgaaagagcttccaagt
gcaaagttggtggtggaaaaattcctgatgcgaagaaaatttattcctgaccctcaaggc
accaatgtgatgtttgctttctttgcgcaacacttcacacaccagttcttcaaaacggat
atggcaaaaggagccgccttcaccaaagcattaggccatggggttgatctcaatcatgtc
tatggggaaaatttagaaaggcaacataaactgcgtttaatgaagggcggcaaactaaaa
tatcagatgatagatggggaaatgtacccaccaacagtgaaaagtgcaggagtagatatg
atgtacccaccccatgttccagaacatcttcagtttgctgttgggcaagaagtttttggc
cttgttcctgggctgatgatgtattccacaatctggttacgggagcacaatcgagtttgt
gacattcttgctggagagcatccagaatgggacgacgagcgtatcttccaaactgcaaga
cttattttgataggtgaaaccatcaagattgtcatagaggattatgtacagcacctcagt
ggatatcacttcaaactcaaatttgacccacaactgttgttcaaccagaaatttcagtat
caaaatagaattgctgcagaattcaataccctgtaccactggcatccccttctacccgac
acttttgccatcaacgaaaaggagtacggttacccacagtttctctacaacaattcgttg
attttaaaccatggcctcactcagatggtcgaatctttcagcaggcagtcagcaggacgt
gttgctggaggtaggaatttccctgctgccataaccagagtagccgtggcatccattgaa
caaagcagagagatgagataccagtcactaaatgaataccgcaagcgtttcatgctcaaa
ccctttgagtcgttcgaagagctgacaggagagaaggaaatgtcagctgaatttgagaaa
ctatacggtgatattgatgccatggaactttatccgggactacttgtggaacagcctcgc
cccggagctatttttggagagaccatggtagagatgggagctccattctctctaaaaggc
ctgatgggaaaccccatatgttctcctgaatactggaaacccagcacctttggcggaagc
gtgggttttgatgttgtaaattccgcctctttacaaaatctgatatgcaacaacgtgaga
gactgtccttacactgcctttcacgtgctaaaaagcaagccttccggaaaggatttcatt
aatgcgagttcagattcaacactggagaatgtaaagccatctttaatcctgaaagagcat
gcgtctgaactttaa

DBGET integrated database retrieval system