KEGG   Xenopus laevis (African clawed frog): 108717476Help
Entry
108717476         CDS       T01010                                 

Gene name
neu4.S
Definition
(RefSeq) neuraminidase 4 (sialidase) S homeolog
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    108717476 (neu4.S)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108717476 (neu4.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     108717476 (neu4.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
5S
AA seq 482 aa AA seqDB search
MGSRHVPARTVLFEKEKNGVTYRVPALLYIPRWLTLLAFAEERLSADDAHANLLVLRRGI
FYRNYVEWEDMHVVERASLPGHRSMNPCPVYDDVTGQLFLFFIAVLGRTTESYQINTGQN
AARLCCVRSLDQGKSWTEVTDLTHKVIGESIKEWATFALGPGHGIHLRNGRLIIPAYTYH
IEKRHCFGSFCQTTARAFVFYSDDHGQSWKLGDLIPNLQTVECQMVSVDEADGNNILYCN
ARSSLGFRVQALSTNDGVVFEPGQLIEKLVETLTGCHGSVIGFPAPLHTLYSPCPDHHLT
TQLKYQKVHTEVSESKNQQKTKGEAKHKYQSNSKLHQWKCQTEDHQGLKETFYKTVPGVR
NPTWVLYSHPTSARSRVNLGVYLSSYPRDADSWTGPWVIYEGPSAYSDLAYLGPPSGEES
ATGSLSVVIFACLYENGLISPYEQISFSIFTLYEVIQNLTPNSAILLQTKMKHRRKESCT
MF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccgccatgtccctgcacgcacagtactttttgagaaggagaaaaatggagtg
acataccgtgtaccagccctgctgtacatcccacgctggctcaccctcttggcctttgca
gaggagaggctaagtgcagatgatgcccatgctaacttgcttgtcctacgacgtggaata
ttttaccgcaactatgtggagtgggaggacatgcatgtagtggagagagcttccctgccc
ggccaccgttccatgaatccttgtccagtctatgatgacgtcactggacaattgttcctc
ttcttcatcgcagtcctaggcaggacaacagaatcttatcagatcaatactggacagaat
gcggcacgtctctgctgtgtgagaagcttagatcagggcaagagttggactgaagtcact
gacctaacccacaaggtcattggggagtcaataaaagagtgggccacatttgccttggga
ccaggtcatggtattcacctgagaaatgggagattgattattcctgcttatacatatcac
attgagaagagacattgctttgggagcttctgtcagaccactgcacgggcttttgtgttc
tacagtgatgaccatggccaaagctggaagttaggagaccttataccaaacttacagact
gtggagtgccagatggtatcagtggatgaggctgatggcaacaatatcctgtactgcaat
gcccgaagctccctaggattccgagtgcaagctctgagcactaatgatggtgttgtattt
gagcctggtcagctgattgagaagttggtggagaccctcacagggtgtcatggaagtgtc
attggttttccagctccactgcacactctgtatagcccatgccctgaccatcacttaacc
acacaactaaagtaccaaaaagtccacactgaagtgtcagaaagtaagaatcagcagaag
acaaagggtgaagctaaacataaatatcagtccaacagcaagttgcatcaatggaaatgc
caaacagaagaccatcaaggactaaaggaaacattctacaagactgtgcctggggtgagg
aatcctacatgggtgctctactcccatccaacaagtgccagatcacgtgtgaaccttggt
gtttatctcagttcatatcccagagatgcagacagctggacaggtccctgggtaatctac
gagggtcccagtgcctattcagaccttgcatatctcgggcccccatctggtgaagaaagt
gcaacagggtccttgtcagttgttatttttgcatgtctctatgaaaacggtctgatttcc
ccatatgagcagatttcattcagtatcttcaccctgtacgaggtcatccagaatttaaca
ccaaactcagcaattcttctccagactaagatgaaacatagaagaaaggagagctgtaca
atgttttaa

DBGET integrated database retrieval system