KEGG   Xenopus laevis (African clawed frog): 379600Help
Entry
379600            CDS       T01010                                 

Gene name
amy2b.L, amy2b
Definition
(RefSeq) amylase, alpha 2B (pancreatic) L homeolog
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    379600 (amy2b.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     379600 (amy2b.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 379600
NCBI-ProteinID: NP_001079910
Xenbase: XB-GENE-6488144
UniProt: Q6PGT2
LinkDB All DBs
Position
4S
AA seq 511 aa AA seqDB search
MKLLLLLVTIGLCSAQYNPNTQSGRTSIVHLFEWKWVDIAAECERYLGPNGFGGVQISPP
NENIVVTNPYRPWWERYQPISYKLCTRSGNEQQFRDMVTRCNNVGVYIYVDAIINHMCGS
GGGAGTHSTCGSYFNAGSRDFPVPYSGLDFNDGKCRTGSGEIENYGDANQVRNCRLVGLL
DLAMEKDYVRGKIAEYMNNLINIGVAGFRLDAAKHMWPGDLKAISDRLNNLNTKWFPAGA
RPFIFQEVIDLGGEAISVNEYFGVGRVTEFKYGAKLGGVIRKWNGEKMAYLRNWGEGWGF
MPNDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMGVGFMLAHPYGFTRVMSSYRWTR
NISNGKDQNDWIGPPTNSDGSIKSVPINADATCGDNWVCEHRWRQIKNMVIFRNVVNGQP
FSNWWDNGSNQVAFGRGNKGFIVFNNDDRYLDATLNTGLPSGTYCDVISGQKEGSRCTGR
QINVDGNGFARFQISNTDEDPFAAIHVNAKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccttctactcttggtgactattgggctctgctcagcccagtacaatcctaac
actcaatccggacgaacatctattgtgcacctgtttgaatggaaatgggttgatattgct
gcagaatgtgagcgctatttgggacctaatggctttggaggtgtccagatttcaccacca
aatgaaaacattgttgtgacaaacccctatagaccctggtgggagaggtaccaacctata
agttataagctctgcactcgttctgggaatgaacaacagtttagagacatggtgacaaga
tgtaacaatgttggggtatatatttatgtggatgccataatcaaccatatgtgtggctca
ggtggcggtgccggcactcattcaacttgtggaagctacttcaatgcaggatccagggat
ttcccagtcccctattccggcttggattttaatgatggaaagtgcaggactggcagtggt
gaaatagaaaattatggggatgctaaccaggtccgaaactgtcgtcttgttggtctcttg
gatttggcaatggagaaagactatgttcgtgggaagattgccgaatacatgaacaatcta
attaacattggggttgctggattcagactggatgctgctaaacatatgtggcctggagac
ctaaaggctatttccgacagactcaataatctgaacacaaaatggttccctgctggagct
cgacctttcatcttccaagaggtaattgatcttgggggtgaagcaatttctgtcaacgaa
tactttggagttggacgagttactgaattcaaatatggtgccaagcttgggggagtcatc
cgcaaatggaatggagaaaagatggcctatctaaggaactggggagaaggctggggattt
atgcccaatgatagagctttggtgtttgttgataatcatgataatcaaagaggacacggt
gctggaggagcttccattctcaccttctgggatgcacgtctgtacaaaatgggagttggc
ttcatgctggcgcatccttatggtttcactcgtgtcatgtctagctacagatggactagg
aacatatcgaatggaaaggaccaaaatgactggattggccctcctactaattctgatggg
tctatcaaatcagttcctatcaacgctgatgcaacatgtggtgacaactgggtctgtgag
catagatggcgccagataaagaacatggttatcttccgtaatgtggtaaatggtcaaccc
ttctcaaactggtgggataatgggagcaatcaagttgcattcggacgtggcaataaagga
ttcatagtctttaataatgatgacaggtacttggatgctactctgaatactggccttcca
agtggaacctactgtgatgtgatctcaggacagaaggagggatctcgctgcacaggcagg
cagatcaatgtggatggaaatggctttgctcgttttcagataagcaacactgatgaagac
ccatttgctgctatccatgtgaatgccaaactataa

DBGET integrated database retrieval system