KEGG   Xiphophorus maculatus (southern platyfish): 102222033Help
Entry
102222033         CDS       T02923                                 

Gene name
abat
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    102222033 (abat)
   00650 Butanoate metabolism
    102222033 (abat)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102222033 (abat)
   00280 Valine, leucine and isoleucine degradation
    102222033 (abat)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102222033 (abat)
Enzymes [BR:xma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102222033 (abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102222033 (abat)
Amino acid related enzymes [BR:xma01007]
 Aminotransferase (transaminase)
  Class III
   102222033 (abat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASCLISRQLSLCVQKNLWLSSAGCRYVSKAAAKTQVEYDYDGPLMKTTVPGPRSQELTK
QLGDIQNVGAVNFFCNYEDSRGNYLVDVDGNRMLDIYTQISSIPIGYNHPALLKLMTNPN
NLSTFVNRPALGILPPENFPEKITESLLSIAPSGMTRVQTMACGSCSNENAFKSIFIWYR
NKERGHNTPSEEELTSCMTNQGPGCPDLSILSFMGGFHGRTLGCLATTHSKVIHKLDIPS
FDWPVAPFPRLKYPLEEFSRENAQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQSEGG
DNHASPDFFRNLRNISRKHGCAFHVDEVQTGGGCTGKFWAHEHWGMDDPAEVVSFSKKLL
TGGYYQKDELQADKPYRIFNTWMGDPSKNLFLVEVLNVIRRENLLEEVARSGKALLNGLY
ELQAQYPGLLSRARGQGTFCAIDVRDAATRDRLLLQARDKGVLLGGCGDQSIRFRPALVF
KEYHVHIFLNIFNDVLAQYK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctgcttgatcagccgtcagctgtctctctgcgtgcagaagaacttatggctg
agctctgcagggtgccgctacgtcagtaaggcagcagcgaagacgcaggtggagtacgac
tatgatggacccttaatgaaaactacagttcctgggccccgatcacaagagctgacaaaa
caactgggagacattcagaatgttggtgcagtcaacttcttttgtaactatgaagacagc
agaggaaactacctggtggacgtggacggcaaccgcatgctggacatctacactcagatc
tcctccattccgattggttacaaccatcctgctctgctcaagctgatgaccaatcccaac
aatctgagcacattcgtgaaccgacctgcgctgggaatcctgccgcctgagaattttcca
gaaaaaatcactgaaagtcttctctcaatcgctcccagtggaatgactcgtgttcagacc
atggcctgtggctcgtgctccaacgagaacgccttcaagtccatattcatctggtacagg
aacaaggagcggggccacaacacaccgtctgaggaggagctgacctcctgcatgacaaac
cagggcccaggatgtccagacctcagcattttgtcttttatgggaggttttcatggcaga
accctgggctgtttggcaacaacacactccaaagtgattcacaagttggatataccgtcg
tttgattggccagttgctccgtttcccagactcaagtatccgctggaggagttcagccga
gagaacgctcaggaagaggcccgctgtctggaggaggtggaggacttgattgtgaagtgg
aggcagaaagggaaacctgttgcaggaatcgttattgaaccgattcagtctgaaggtgga
gataaccacgcctccccagacttcttcagaaacctccgcaacatttcacgcaagcatggc
tgtgcttttcacgtggatgaggtccagaccggcggcggatgcacggggaagttctgggcc
catgagcactggggcatggacgacccggcagaggtcgtctccttcagtaagaagctgctg
acgggaggctactaccagaaggacgaactgcaggccgataagccgtaccgtatttttaac
acctggatgggagacccgtccaagaacttgttcctggttgaggttcttaacgtgatccgc
agagagaatctcctggaggaagtggcccgctctgggaaggctctgctgaacggcctctat
gagctgcaggctcagtacccgggcctgctgagccgagctcgaggacaggggacgttctgt
gccattgatgtgcgggacgctgccacgcgagacagactgctgttgcaagccagagacaaa
ggcgtgctcctgggaggatgtggggaccagtccatccgtttccgtcctgctctcgtcttt
aaggagtaccacgtccacatcttcctcaacatctttaacgacgtcctggctcagtacaaa
taa

DBGET integrated database retrieval system